Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6023
Gene name
LocationContig_629:5107..6368
Strand-
Gene length (bp)1261
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03060 NMO Nitronate monooxygenase 2.4E-56 9 287
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 6.1E-11 6 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 6 368 2.0E-34
sp|O06179|Y1533_MYCTU Putative monooxygenase Rv1533 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1533 PE=1 SV=1 7 381 5.0E-31
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 8 305 3.0E-27
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 8 305 3.0E-27
sp|A6U025|2NPD_STAA2 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1 8 305 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 6 368 2.0E-34
sp|O06179|Y1533_MYCTU Putative monooxygenase Rv1533 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1533 PE=1 SV=1 7 381 5.0E-31
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 8 305 3.0E-27
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 8 305 3.0E-27
sp|A6U025|2NPD_STAA2 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1 8 305 3.0E-27
sp|Q6GB05|2NPD_STAAS Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1 8 305 5.0E-27
sp|Q6GIG7|2NPD_STAAR Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1 8 305 8.0E-27
sp|Q8NXG7|2NPD_STAAW Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MW2) GN=MW0803 PE=3 SV=1 8 305 2.0E-26
sp|Q4L4T4|2NPD_STAHJ Probable nitronate monooxygenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2032 PE=3 SV=1 11 286 2.0E-26
sp|A8Z1H7|2NPD_STAAT Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_0879 PE=3 SV=1 8 305 4.0E-26
sp|Q2FIF3|2NPD_STAA3 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0825 PE=3 SV=1 8 305 4.0E-26
sp|Q2FZX9|2NPD_STAA8 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00855 PE=3 SV=1 8 305 4.0E-26
sp|Q5HHG4|2NPD_STAAC Probable nitronate monooxygenase OS=Staphylococcus aureus (strain COL) GN=SACOL0922 PE=3 SV=1 8 305 4.0E-26
sp|A6QFD2|2NPD_STAAE Probable nitronate monooxygenase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0792 PE=3 SV=1 8 305 4.0E-26
sp|O05413|2NPD_BACSU Probable nitronate monooxygenase OS=Bacillus subtilis (strain 168) GN=yrpB PE=3 SV=1 15 306 6.0E-23
sp|Q9I4V0|2NPD_PSEAE Nitronate monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1024 PE=1 SV=1 7 269 2.0E-19
sp|Q12723|2NPD_CYBMR Nitronate monooxygenase OS=Cyberlindnera mrakii PE=3 SV=1 15 278 3.0E-13
sp|P47177|2NDP_YEAST Putative nitronate monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR149W PE=1 SV=2 118 286 5.0E-09
sp|Q01284|2NPD_NEUCR Nitronate monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ncd-2 PE=1 SV=1 3 310 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0018580 nitronate monooxygenase activity Yes
GO:0003824 catalytic activity Yes
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0004497 monooxygenase activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup125
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2776
Ophiocordyceps australis 1348a (Ghana) OphauG2|5872
Ophiocordyceps australis map64 (Brazil) OphauB2|1928
Ophiocordyceps australis map64 (Brazil) OphauB2|2687
Ophiocordyceps camponoti-floridani Ophcf2|03116
Ophiocordyceps camponoti-floridani Ophcf2|04066
Ophiocordyceps camponoti-rufipedis Ophun1|449
Ophiocordyceps camponoti-rufipedis Ophun1|6023 (this protein)
Ophiocordyceps kimflemingae Ophio5|6568
Ophiocordyceps kimflemingae Ophio5|8097
Ophiocordyceps subramaniannii Hirsu2|10080
Ophiocordyceps subramaniannii Hirsu2|1120

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6023
MASPQKIRTPITDLFKIKHPVLLAGMNVAAGPKLAAAVTNAGGLGVIGGVGYTPDMLREQIAELKDYLVDKNGPF
GVDLLLPQVGGSARKTKSDSPSYDYTKGKLDELVDIIIDSGAKLFVSAVGVPPKAVVDRIHQAGIVYMNMVGHVK
HVNKCLDLGVDIICAQGGEGGGHTGDIPTTVLIPAVVEICQKATSPLTGGPVQVIAAGGIHNGQLLAASLMMGAS
AVWVGTRFVLTDEAGAPRAHKDAVRTAGHDDNVRTIIFTGRPMRVRNNPYINDWETNRQQEMRELAAKGTIPYEA
DVDKYLDAGSDSPKGVEANNAGASSAGDDGDFDDPLEQFRPFLMGKCAAVVNEQKSAKAVVDEFVDDAVKCIQAG
QKMVARL*
Coding >Ophun1|6023
ATGGCCTCTCCGCAAAAGATCCGCACCCCCATCACCGATCTCTTCAAGATCAAGCATCCCGTCCTCCTAGCCGGC
ATGAACGTCGCCGCCGGCCCGAAGCTAGCCGCCGCCGTCACCAACGCAGGCGGCCTCGGCGTCATCGGCGGCGTC
GGATACACGCCCGACATGCTCCGCGAGCAGATTGCAGAGCTCAAGGATTACCTCGTCGATAAGAATGGTCCGTTT
GGTGTCGATCTGCTACTACCGCAGGTCGGGGGCAGCGCTCGAAAGACAAAGTCTGATTCCCCCTCCTACGACTAC
ACAAAGGGTAAACTCGACGAGCTGGTAGACATCATCATCGACTCCGGCGCCAAACTCTTCGTCTCAGCCGTCGGC
GTCCCCCCCAAAGCCGTCGTCGACCGCATCCACCAAGCAGGCATCGTCTACATGAACATGGTCGGCCACGTCAAG
CACGTCAACAAATGCCTCGACCTCGGCGTCGACATCATCTGCGCCCAGGGCGGCGAAGGGGGCGGCCACACAGGC
GACATCCCCACCACCGTCCTCATCCCCGCCGTCGTCGAAATCTGCCAAAAGGCCACCTCCCCCCTGACAGGAGGT
CCCGTACAGGTCATCGCCGCGGGCGGCATCCACAACGGCCAGCTCCTGGCCGCCTCTCTGATGATGGGCGCCTCG
GCAGTCTGGGTGGGGACCCGCTTCGTGCTAACAGACGAAGCCGGCGCCCCTCGAGCCCATAAAGACGCCGTCCGC
ACCGCCGGCCACGACGATAACGTCCGCACCATCATCTTCACCGGCCGGCCCATGCGCGTACGCAACAACCCCTAC
ATCAACGACTGGGAGACGAACCGCCAGCAGGAGATGCGCGAGCTCGCCGCAAAGGGCACCATCCCCTACGAAGCC
GACGTCGACAAGTACCTCGACGCCGGCTCCGATTCCCCCAAAGGCGTCGAGGCCAACAACGCCGGTGCCTCGAGC
GCAGGCGACGACGGGGACTTTGACGATCCGCTCGAGCAGTTCCGTCCGTTTCTCATGGGCAAGTGTGCTGCTGTC
GTCAACGAGCAAAAGTCGGCAAAGGCTGTGGTTGATGAGTTTGTTGATGATGCGGTCAAGTGCATCCAGGCTGGC
CAGAAGATGGTGGCCAGGTTGTGA
Transcript >Ophun1|6023
ATGGCCTCTCCGCAAAAGATCCGCACCCCCATCACCGATCTCTTCAAGATCAAGCATCCCGTCCTCCTAGCCGGC
ATGAACGTCGCCGCCGGCCCGAAGCTAGCCGCCGCCGTCACCAACGCAGGCGGCCTCGGCGTCATCGGCGGCGTC
GGATACACGCCCGACATGCTCCGCGAGCAGATTGCAGAGCTCAAGGATTACCTCGTCGATAAGAATGGTCCGTTT
GGTGTCGATCTGCTACTACCGCAGGTCGGGGGCAGCGCTCGAAAGACAAAGTCTGATTCCCCCTCCTACGACTAC
ACAAAGGGTAAACTCGACGAGCTGGTAGACATCATCATCGACTCCGGCGCCAAACTCTTCGTCTCAGCCGTCGGC
GTCCCCCCCAAAGCCGTCGTCGACCGCATCCACCAAGCAGGCATCGTCTACATGAACATGGTCGGCCACGTCAAG
CACGTCAACAAATGCCTCGACCTCGGCGTCGACATCATCTGCGCCCAGGGCGGCGAAGGGGGCGGCCACACAGGC
GACATCCCCACCACCGTCCTCATCCCCGCCGTCGTCGAAATCTGCCAAAAGGCCACCTCCCCCCTGACAGGAGGT
CCCGTACAGGTCATCGCCGCGGGCGGCATCCACAACGGCCAGCTCCTGGCCGCCTCTCTGATGATGGGCGCCTCG
GCAGTCTGGGTGGGGACCCGCTTCGTGCTAACAGACGAAGCCGGCGCCCCTCGAGCCCATAAAGACGCCGTCCGC
ACCGCCGGCCACGACGATAACGTCCGCACCATCATCTTCACCGGCCGGCCCATGCGCGTACGCAACAACCCCTAC
ATCAACGACTGGGAGACGAACCGCCAGCAGGAGATGCGCGAGCTCGCCGCAAAGGGCACCATCCCCTACGAAGCC
GACGTCGACAAGTACCTCGACGCCGGCTCCGATTCCCCCAAAGGCGTCGAGGCCAACAACGCCGGTGCCTCGAGC
GCAGGCGACGACGGGGACTTTGACGATCCGCTCGAGCAGTTCCGTCCGTTTCTCATGGGCAAGTGTGCTGCTGTC
GTCAACGAGCAAAAGTCGGCAAAGGCTGTGGTTGATGAGTTTGTTGATGATGCGGTCAAGTGCATCCAGGCTGGC
CAGAAGATGGTGGCCAGGTTGTGA
Gene >Ophun1|6023
ATGGCCTCTCCGCGTACGTCCGCCACCCGAACAAGCCCATCAACCACACAACTAACAAGCCCAAACCCACAGAAA
AGATCCGCACCCCCATCACCGATCTCTTCAAGATCAAGCATCCCGTCCTCCTAGCCGGCATGAACGTCGCCGCCG
GCCCGAAGCTAGCCGCCGCCGTCACCAACGCAGGCGGCCTCGGCGTCATCGGCGGCGTCGGATACACGCCCGACA
TGCTCCGCGAGCAGATTGCAGAGCTCAAGGATTACCTCGTCGATAAGAATGGTCCGTTTGGTGTCGATCTGCTAC
TACCGCAGGTCGGGGGCAGCGCTCGAAAGACAAAGTCTGATTCCCCCTCGTCCGCTACACGAATATCGAATATAT
GACTGACGGACATGTGTGTCTACGCAGCTACGACTACACAAAGGGTAAACTCGACGAGCTGGTAGACATCATCAT
CGACTCCGGCGCCAAACTCTTCGTCTCAGCCGTCGGCGTCCCCCCCAAAGCCGTCGTCGACCGCATCCACCAAGC
AGGCATCGTCTACATGAACATGGTCGGCCACGTCAAGCACGTCAACAAATGCCTCGACCTCGGCGTCGACATCAT
CTGCGCCCAGGGCGGCGAAGGGGGCGGCCACACAGGCGACATCCCCACCACCGTCCTCATCCCCGCCGTCGTCGA
AATCTGCCAAAAGGCCACCTCCCCCCTGACAGGAGGTCCCGTACAGGTCATCGCCGCGGGCGGCATCCACAACGG
CCAGCTCCTGGCCGCCTCTCTGATGATGGGCGCCTCGGCAGTCTGGGTGGGGACCCGCTTCGTGCTAACAGACGA
AGCCGGCGCCCCTCGAGCCCATAAAGACGCCGTCCGCACCGCCGGCCACGACGATAACGTCCGCACCATCATCTT
CACCGGCCGGCCCATGCGCGTACGCAACAACCCCTACATCAACGACTGGGAGACGAACCGCCAGCAGGAGATGCG
CGAGCTCGCCGCAAAGGGCACCATCCCCTACGAAGCCGACGTCGACAAGTACCTCGACGCCGGCTCCGATTCCCC
CAAAGGCGTCGAGGCCAACAACGCCGGTGCCTCGAGCGCAGGCGACGACGGGGACTTTGACGATCCGCTCGAGCA
GTTCCGTCCGTTTCTCATGGGCAAGTGTGCTGCTGTCGTCAACGAGCAAAAGTCGGCAAAGGCTGTGGTTGATGA
GTTTGTTGATGATGCGGTCAAGTGCATCCAGGCTGGCCAGAAGATGGTGGCCAGGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail