Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6021
Gene name
LocationContig_629:1802..2663
Strand-
Gene length (bp)861
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08294 TIM21 TIM21 9.7E-11 65 119
PF08294 TIM21 TIM21 6.2E-14 122 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ95|TIM21_GIBZE Mitochondrial import inner membrane translocase subunit TIM21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM21 PE=3 SV=1 1 198 8.0E-76
sp|Q7S8S5|TIM21_NEUCR Mitochondrial import inner membrane translocase subunit tim21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim21 PE=3 SV=1 42 198 2.0E-49
sp|Q4X1I8|TIM21_ASPFU Mitochondrial import inner membrane translocase subunit tim21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim21 PE=3 SV=1 1 198 7.0E-42
sp|Q6CAQ9|TIM21_YARLI Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1 77 200 1.0E-14
sp|Q75CX4|TIM21_ASHGO Mitochondrial import inner membrane translocase subunit TIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM21 PE=3 SV=1 77 199 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ95|TIM21_GIBZE Mitochondrial import inner membrane translocase subunit TIM21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM21 PE=3 SV=1 1 198 8.0E-76
sp|Q7S8S5|TIM21_NEUCR Mitochondrial import inner membrane translocase subunit tim21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim21 PE=3 SV=1 42 198 2.0E-49
sp|Q4X1I8|TIM21_ASPFU Mitochondrial import inner membrane translocase subunit tim21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim21 PE=3 SV=1 1 198 7.0E-42
sp|Q6CAQ9|TIM21_YARLI Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1 77 200 1.0E-14
sp|Q75CX4|TIM21_ASHGO Mitochondrial import inner membrane translocase subunit TIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM21 PE=3 SV=1 77 199 6.0E-07
sp|O94618|TIM21_SCHPO Mitochondrial import inner membrane translocase subunit tim21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim21 PE=3 SV=1 6 199 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Yes
GO:0030150 protein import into mitochondrial matrix Yes
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0044743 protein transmembrane import into intracellular organelle No
GO:0006839 mitochondrial transport No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0032991 protein-containing complex No
GO:0070585 protein localization to mitochondrion No
GO:0098796 membrane protein complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0033365 protein localization to organelle No
GO:0046907 intracellular transport No
GO:0071806 protein transmembrane transport No
GO:0008104 protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0071702 organic substance transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0072594 establishment of protein localization to organelle No
GO:0070727 cellular macromolecule localization No
GO:0055085 transmembrane transport No
GO:1990542 mitochondrial transmembrane transport No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0065002 intracellular protein transmembrane transport No
GO:0045184 establishment of protein localization No
GO:0006886 intracellular protein transport No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0008150 biological_process No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6021
MRPNLLLRTTRSGACSTSFPGLASRTYSSQTGLGAAAAPKQRRQSITPFNDNGSVPWRELSVTEKMARTTQQGFN
GGLIAIGLVLTGTVVYFLWTDVFSPDSKVSQFNRAVDRIKKDARYSEKVDARGDSHLMMHFYVDGPLQDGVAQLH
MVKRQGESDYEYRYFFVDVKGHDRVYLEKASPETGAGKKQLSLFGVKWGR*
Coding >Ophun1|6021
ATGAGACCGAACCTCCTATTGCGGACCACTCGTTCGGGCGCCTGCTCCACCTCGTTTCCGGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACCGGCCTCGGAGCTGCGGCCGCGCCCAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGGGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGATCGCCATCGGCCTCGTGCTAACGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTCTCCCCC
GACAGCAAAGTCTCCCAATTCAACCGCGCCGTCGACAGAATCAAAAAAGACGCCAGGTACTCTGAAAAAGTGGAC
GCTCGGGGAGACTCGCATCTCATGATGCACTTTTACGTCGATGGACCTCTGCAGGATGGCGTGGCGCAGCTGCAC
ATGGTGAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGGCATGATCGCGTC
TACCTGGAAAAGGCCTCGCCCGAGACGGGCGCGGGGAAGAAGCAGCTGAGTCTCTTTGGCGTCAAATGGGGTCGA
TGA
Transcript >Ophun1|6021
ATGAGACCGAACCTCCTATTGCGGACCACTCGTTCGGGCGCCTGCTCCACCTCGTTTCCGGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACCGGCCTCGGAGCTGCGGCCGCGCCCAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGGGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGATCGCCATCGGCCTCGTGCTAACGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTCTCCCCC
GACAGCAAAGTCTCCCAATTCAACCGCGCCGTCGACAGAATCAAAAAAGACGCCAGGTACTCTGAAAAAGTGGAC
GCTCGGGGAGACTCGCATCTCATGATGCACTTTTACGTCGATGGACCTCTGCAGGATGGCGTGGCGCAGCTGCAC
ATGGTGAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGGCATGATCGCGTC
TACCTGGAAAAGGCCTCGCCCGAGACGGGCGCGGGGAAGAAGCAGCTGAGTCTCTTTGGCGTCAAATGGGGTCGA
TGA
Gene >Ophun1|6021
ATGAGACCGAACCTCCTATTGCGGACCACTCGTTCGGGCGCCTGCTCCACCTCGTTTCCGGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACCGGCCTCGGAGCTGCGGCCGCGCCCAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGGGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGATCGCCATCGGCCTCGTGCTAACGGTGCGGCCTCCAAAGTCCACCCTTGCCGGCCCAACACTGACA
CCAGCCAGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTCTCCCCCGACAGCAAAGTCTCCCAATTCAACC
GCGCCGTCGACAGAATCAAAAAAGACGCCAGGTGCATCCAGCTACTAGGAGAGGCCCACAGGATCACAGCCCACG
GAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTGAGGCGCCCCTTTGATCTTGTACATATATA
CACACTCTGCTCCGGTCGCTGACGCCCATGCAGGTACTCTGAAAAAGTGGACGCTCGGGGAGACTCGCATCTCAT
GATGCACTTTTACGTGAGTGCGGCCGCACCGCAGACAGGCACAAGAGGCGCTGACGACATGACTATCAGGTCGAT
GGACCTCTGCAGGATGGCGTGGCGCAGCTGCACATGGTGAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTAT
TTCTTCGTGGACGTCAAGGGGCATGATCGCGTCTACCTGGAAAAGGCCTCGCCCGAGACGGGCGCGGGGAAGAAG
CAGCTGAGTCTCTTTGGCGTCAAATGGGGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail