Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6019
Gene name
LocationContig_628:1131..7980
Strand-
Gene length (bp)6849
Transcript length (bp)6534
Coding sequence length (bp)6534
Protein length (aa) 2178

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 5.8E-55 1445 1696
PF13855 LRR_8 Leucine rich repeat 9.6E-07 756 812
PF13855 LRR_8 Leucine rich repeat 1.9E-06 801 857
PF13855 LRR_8 Leucine rich repeat 2.2E-06 894 950
PF13855 LRR_8 Leucine rich repeat 2.1E-08 1225 1285
PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain 3.1E-30 1764 1921
PF08509 Ad_cyc_g-alpha Adenylate cyclase G-alpha binding domain 7.4E-11 510 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 88 2151 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 131 2173 0.0E+00
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 1192 2073 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 863 2139 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 983 2114 2.0E-180
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 88 2151 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 131 2173 0.0E+00
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 1192 2073 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 863 2139 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 983 2114 2.0E-180
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 1225 2000 7.0E-122
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 612 1089 2.0E-89
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 574 1091 4.0E-56
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 612 1062 1.0E-53
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 612 1088 1.0E-50
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 707 1089 5.0E-30
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 746 1089 2.0E-28
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 768 1089 6.0E-28
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 736 1090 1.0E-27
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 729 1089 1.0E-27
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 753 1090 2.0E-27
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 727 1090 3.0E-27
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 746 1089 3.0E-27
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 1764 1924 5.0E-27
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 727 1090 9.0E-27
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 729 1089 1.0E-26
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 746 1125 4.0E-26
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 1751 1922 6.0E-26
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 730 1090 7.0E-26
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 731 1089 1.0E-25
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 731 1089 2.0E-25
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 731 1089 3.0E-25
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 728 1089 5.0E-25
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 731 1089 6.0E-25
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 740 1090 7.0E-25
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 726 1090 2.0E-24
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 728 1089 2.0E-24
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 704 1089 4.0E-24
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 726 1090 4.0E-24
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 755 1090 5.0E-24
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 720 1090 6.0E-24
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 722 1090 6.0E-24
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 722 1090 7.0E-24
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 722 1090 7.0E-24
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 726 1090 8.0E-24
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 726 1090 9.0E-24
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 725 1089 2.0E-23
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 726 1090 2.0E-23
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 730 1090 3.0E-23
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 722 1090 3.0E-23
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 1226 1722 3.0E-23
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 665 1089 4.0E-23
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 728 1060 8.0E-23
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 773 1088 9.0E-23
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 728 1089 9.0E-23
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 1226 1722 1.0E-22
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 787 1055 1.0E-22
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 734 1092 2.0E-22
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 734 1076 2.0E-22
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 726 1090 2.0E-22
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 788 1067 3.0E-22
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 1226 1706 4.0E-22
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 726 1090 5.0E-22
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 703 1069 1.0E-21
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 728 1069 1.0E-21
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 665 1089 2.0E-21
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 732 1089 2.0E-21
sp|Q25263|CYAB_LEIDO Receptor-type adenylate cyclase B OS=Leishmania donovani GN=RAC-B PE=2 SV=1 1768 1917 2.0E-21
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 728 1069 3.0E-21
sp|Q27675|CYAA_LEIDO Receptor-type adenylate cyclase A OS=Leishmania donovani GN=RAC-A PE=2 SV=1 1768 1917 3.0E-21
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 740 1089 3.0E-21
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 773 1088 4.0E-21
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 705 1102 7.0E-21
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 731 1090 8.0E-21
sp|P26338|CYAA_TRYEQ Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma equiperdum GN=ESAG4C PE=3 SV=1 1768 2006 8.0E-21
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 728 1089 9.0E-21
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 754 1120 9.0E-21
sp|Q99280|CY43_TRYBB Receptor-type adenylate cyclase GRESAG 4.3 OS=Trypanosoma brucei brucei GN=GRESAG 4.3 PE=1 SV=1 1764 1917 1.0E-20
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 773 1089 2.0E-20
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 728 1093 2.0E-20
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 778 1090 3.0E-20
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 1758 1945 3.0E-20
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 778 1085 7.0E-20
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 746 1069 8.0E-20
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 701 1102 9.0E-20
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 701 1102 9.0E-20
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 701 1102 9.0E-20
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 701 1102 1.0E-19
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 734 1088 1.0E-19
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 741 1090 1.0E-19
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 725 932 2.0E-19
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 703 1069 2.0E-19
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 723 1092 2.0E-19
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 703 1069 3.0E-19
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 701 1102 3.0E-19
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 758 1102 3.0E-19
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 824 1089 3.0E-19
sp|Q26721|CYA4_TRYBB Receptor-type adenylate cyclase ESAG 4 OS=Trypanosoma brucei brucei GN=ESAG4 PE=3 SV=1 1768 2006 3.0E-19
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 777 1046 3.0E-19
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 703 1069 4.0E-19
sp|Q26896|CYAA_TRYCO Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma congolense PE=2 SV=1 1768 1917 4.0E-19
sp|Q99279|CY41_TRYBB Receptor-type adenylate cyclase GRESAG 4.1 OS=Trypanosoma brucei brucei GN=GRESAG 4.1 PE=1 SV=1 1764 1990 4.0E-19
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 703 1069 5.0E-19
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 802 1331 6.0E-19
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 703 1069 7.0E-19
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 703 1069 7.0E-19
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 782 1023 7.0E-19
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 703 1069 9.0E-19
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 758 1089 9.0E-19
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 658 1069 1.0E-18
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 739 1089 1.0E-18
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 784 1046 1.0E-18
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 764 1094 1.0E-18
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 759 1083 1.0E-18
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 801 1089 1.0E-18
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 792 1069 1.0E-18
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 703 1069 2.0E-18
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 686 1069 2.0E-18
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 792 1082 2.0E-18
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 728 1060 4.0E-18
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 767 1074 5.0E-18
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 728 1060 5.0E-18
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 729 1067 6.0E-18
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 729 1102 6.0E-18
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 746 1090 6.0E-18
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 789 1089 7.0E-18
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 758 1089 7.0E-18
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 828 1068 7.0E-18
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 755 1123 9.0E-18
sp|Q99396|CY42_TRYBB Receptor-type adenylate cyclase GRESAG 4.2 (Fragment) OS=Trypanosoma brucei brucei GN=GRESAG 4.2 PE=2 SV=1 1768 1919 9.0E-18
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 784 1061 1.0E-17
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 753 1047 2.0E-17
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 723 1067 2.0E-17
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 755 929 2.0E-17
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 749 1067 3.0E-17
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 754 1071 3.0E-17
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 736 1095 3.0E-17
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 789 1094 4.0E-17
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 734 1089 4.0E-17
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 734 1090 4.0E-17
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 725 1045 4.0E-17
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 1429 1707 4.0E-17
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 728 1067 5.0E-17
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 728 1067 6.0E-17
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 1396 1702 6.0E-17
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 736 1095 7.0E-17
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 728 1069 7.0E-17
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 852 1089 8.0E-17
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 713 1085 1.0E-16
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 826 1090 1.0E-16
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 1396 1702 1.0E-16
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 827 1089 2.0E-16
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 782 1022 2.0E-16
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 777 974 2.0E-16
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 728 1069 2.0E-16
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 743 1085 2.0E-16
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 775 1089 3.0E-16
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 1396 1683 3.0E-16
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 768 1336 4.0E-16
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 777 949 5.0E-16
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 730 945 6.0E-16
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 1429 1702 7.0E-16
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 736 929 7.0E-16
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 782 1023 8.0E-16
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 734 1102 1.0E-15
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 779 1069 1.0E-15
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 724 1085 1.0E-15
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 733 1089 1.0E-15
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 1425 1671 2.0E-15
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 773 1094 2.0E-15
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 805 1069 2.0E-15
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 729 1085 2.0E-15
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 790 1089 3.0E-15
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 847 1090 3.0E-15
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 839 1093 3.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 839 1097 3.0E-15
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 736 1085 3.0E-15
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 758 929 3.0E-15
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 826 1089 4.0E-15
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 846 1320 4.0E-15
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 778 1089 4.0E-15
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 767 902 5.0E-15
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 795 1061 6.0E-15
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 1425 1702 7.0E-15
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 1429 1662 7.0E-15
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 729 1045 8.0E-15
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 773 1094 8.0E-15
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 847 1090 1.0E-14
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 734 1096 1.0E-14
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 778 1089 1.0E-14
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 801 1046 1.0E-14
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 1427 1702 1.0E-14
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 734 1088 1.0E-14
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 773 1068 1.0E-14
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 741 929 1.0E-14
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 768 1090 2.0E-14
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 767 902 2.0E-14
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 734 942 2.0E-14
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 1425 1702 2.0E-14
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 729 911 2.0E-14
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 767 902 2.0E-14
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 1459 1702 2.0E-14
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 828 1089 3.0E-14
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 773 1090 3.0E-14
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 729 1093 3.0E-14
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 829 1089 4.0E-14
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 1425 1702 4.0E-14
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 786 1083 4.0E-14
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 826 1090 5.0E-14
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 740 1087 5.0E-14
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 734 1090 6.0E-14
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 736 1069 6.0E-14
sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 734 1088 6.0E-14
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 1247 1702 6.0E-14
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 703 1085 6.0E-14
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 731 932 7.0E-14
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 771 1336 7.0E-14
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 1550 1663 7.0E-14
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 795 1093 8.0E-14
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 771 1067 9.0E-14
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 729 1049 1.0E-13
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 849 1063 1.0E-13
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 1451 1714 1.0E-13
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 728 1085 1.0E-13
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 708 1069 1.0E-13
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 1425 1702 1.0E-13
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 779 1097 2.0E-13
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 730 932 2.0E-13
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 852 1090 2.0E-13
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 752 1062 2.0E-13
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 801 1069 2.0E-13
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 828 1090 2.0E-13
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 725 956 2.0E-13
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 726 906 2.0E-13
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 1459 1702 2.0E-13
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 1459 1707 2.0E-13
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 1427 1702 2.0E-13
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 828 1069 2.0E-13
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 729 1083 3.0E-13
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 734 1090 3.0E-13
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 731 1023 3.0E-13
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 636 1090 3.0E-13
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 728 1090 4.0E-13
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 751 971 4.0E-13
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 730 953 4.0E-13
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 814 1067 4.0E-13
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 1425 1661 4.0E-13
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 777 1060 4.0E-13
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 773 1060 4.0E-13
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 731 905 5.0E-13
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 850 1070 5.0E-13
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 792 1093 5.0E-13
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 743 1089 6.0E-13
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 736 1085 7.0E-13
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 730 1062 7.0E-13
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 734 1090 7.0E-13
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 856 1069 7.0E-13
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 1425 1684 7.0E-13
sp|O93233|PLIB_GLOBS Phospholipase A2 inhibitor OS=Gloydius brevicaudus siniticus PE=1 SV=1 753 989 7.0E-13
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 856 1069 8.0E-13
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 725 1099 8.0E-13
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 829 1020 8.0E-13
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 1398 1702 8.0E-13
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 744 1069 9.0E-13
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 1459 1661 9.0E-13
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 829 1014 9.0E-13
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 870 1093 1.0E-12
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 829 1096 1.0E-12
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 724 952 1.0E-12
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 734 943 1.0E-12
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 852 1090 1.0E-12
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 724 1085 1.0E-12
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 1459 1702 1.0E-12
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 723 911 1.0E-12
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 749 1070 1.0E-12
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 1446 1709 1.0E-12
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 759 1075 1.0E-12
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 1459 1661 1.0E-12
sp|Q940E8|FEA2_MAIZE Leucine-rich repeat receptor-like protein FASCIATED EAR2 OS=Zea mays GN=FEA2 PE=1 SV=1 755 1118 1.0E-12
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 1548 1713 1.0E-12
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 1429 1715 1.0E-12
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 839 1096 2.0E-12
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 734 943 2.0E-12
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 724 1088 2.0E-12
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 728 1068 2.0E-12
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 780 1070 2.0E-12
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 752 1086 2.0E-12
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 743 1085 2.0E-12
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 727 943 2.0E-12
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 1446 1709 2.0E-12
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 1446 1709 2.0E-12
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 786 1085 2.0E-12
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 1459 1661 2.0E-12
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 875 1089 2.0E-12
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 1459 1709 2.0E-12
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 875 1089 2.0E-12
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 727 941 2.0E-12
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 1425 1684 2.0E-12
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 777 1094 2.0E-12
sp|E9Q7T7|CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus GN=Chadl PE=1 SV=1 782 1359 2.0E-12
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 724 889 2.0E-12
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 875 1089 2.0E-12
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 829 1020 2.0E-12
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 749 1116 3.0E-12
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 824 1069 3.0E-12
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 868 1093 3.0E-12
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 794 1085 3.0E-12
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 723 1081 4.0E-12
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 755 1090 4.0E-12
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 1278 1702 4.0E-12
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 852 1090 4.0E-12
sp|E9Q7T7|CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus GN=Chadl PE=1 SV=1 730 1002 4.0E-12
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 753 931 4.0E-12
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 862 1333 4.0E-12
sp|P02750|A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens GN=LRG1 PE=1 SV=2 733 932 4.0E-12
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 734 931 4.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 734 931 4.0E-12
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 829 1066 5.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 723 929 5.0E-12
sp|P23515|OMGP_HUMAN Oligodendrocyte-myelin glycoprotein OS=Homo sapiens GN=OMG PE=1 SV=2 728 927 5.0E-12
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 1542 1709 5.0E-12
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 734 1090 6.0E-12
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 778 929 6.0E-12
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 790 1046 8.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 782 1050 8.0E-12
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 725 1085 9.0E-12
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 1427 1690 9.0E-12
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 1459 1661 9.0E-12
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 753 1065 9.0E-12
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 875 1094 1.0E-11
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 875 1094 1.0E-11
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 743 1085 1.0E-11
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 715 1042 1.0E-11
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 767 965 1.0E-11
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 819 1009 1.0E-11
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 805 1089 1.0E-11
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 720 914 2.0E-11
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 731 947 2.0E-11
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 730 925 2.0E-11
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 729 932 2.0E-11
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 726 906 2.0E-11
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 725 910 2.0E-11
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 725 910 2.0E-11
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 1429 1683 2.0E-11
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 804 1066 2.0E-11
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 775 938 2.0E-11
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 1455 1661 2.0E-11
sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2 849 1338 2.0E-11
sp|Q5JKN1|P2C05_ORYSJ Probable protein phosphatase 2C 5 OS=Oryza sativa subsp. japonica GN=Os01g0552300 PE=2 SV=1 1462 1709 2.0E-11
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 734 904 2.0E-11
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 791 1086 2.0E-11
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 1459 1684 2.0E-11
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 736 1095 2.0E-11
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 852 1090 3.0E-11
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 725 910 3.0E-11
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 724 889 3.0E-11
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 741 910 4.0E-11
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 875 1090 4.0E-11
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 728 1293 4.0E-11
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 1460 1712 4.0E-11
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 1429 1672 4.0E-11
sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 819 1085 4.0E-11
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 714 1018 4.0E-11
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 1544 1706 4.0E-11
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 1548 1695 4.0E-11
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 734 1065 4.0E-11
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 731 1083 5.0E-11
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 724 1078 5.0E-11
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 749 1336 5.0E-11
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 949 1090 5.0E-11
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 734 903 6.0E-11
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 790 1046 6.0E-11
sp|P51890|LUM_CHICK Lumican OS=Gallus gallus GN=LUM PE=1 SV=1 786 1049 6.0E-11
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 867 1089 7.0E-11
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 729 1359 7.0E-11
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 773 949 7.0E-11
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 777 944 7.0E-11
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 814 1044 8.0E-11
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 852 1067 8.0E-11
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 730 1085 8.0E-11
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 726 906 8.0E-11
sp|A6NIK2|LR10B_HUMAN Leucine-rich repeat-containing protein 10B OS=Homo sapiens GN=LRRC10B PE=4 SV=2 780 953 8.0E-11
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 802 1065 8.0E-11
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 867 1334 9.0E-11
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 729 1090 9.0E-11
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 767 896 9.0E-11
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 773 1090 9.0E-11
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 867 1089 1.0E-10
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 734 903 1.0E-10
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 724 1029 1.0E-10
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 799 1089 1.0E-10
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 914 1089 1.0E-10
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 779 1065 1.0E-10
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 780 1085 1.0E-10
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 1427 1702 1.0E-10
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 1429 1661 1.0E-10
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 1429 1671 1.0E-10
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 875 1089 1.0E-10
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 1403 1671 1.0E-10
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 1429 1672 1.0E-10
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 721 1069 1.0E-10
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 708 972 1.0E-10
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 716 1090 1.0E-10
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 747 1060 1.0E-10
sp|Q63912|OMGP_MOUSE Oligodendrocyte-myelin glycoprotein OS=Mus musculus GN=Omg PE=1 SV=1 723 927 1.0E-10
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 875 1089 2.0E-10
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 828 1089 2.0E-10
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 724 1105 2.0E-10
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 770 944 2.0E-10
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 852 1089 2.0E-10
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 792 1078 2.0E-10
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 734 903 2.0E-10
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 791 1074 2.0E-10
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 802 1085 2.0E-10
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 752 932 2.0E-10
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 866 1069 2.0E-10
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 708 929 2.0E-10
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 1224 1465 2.0E-10
sp|Q32KX5|LRC28_BOVIN Leucine-rich repeat-containing protein 28 OS=Bos taurus GN=LRRC28 PE=2 SV=1 723 903 2.0E-10
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 792 1359 2.0E-10
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 723 903 2.0E-10
sp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 OS=Arabidopsis thaliana GN=PXC3 PE=2 SV=1 749 1100 2.0E-10
sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 868 1133 2.0E-10
sp|Q9DE67|LUM_COTJA Lumican OS=Coturnix coturnix japonica GN=LUM PE=2 SV=1 786 1049 2.0E-10
sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 778 983 2.0E-10
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 1435 1703 2.0E-10
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 858 1089 3.0E-10
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 867 1334 3.0E-10
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 743 1127 3.0E-10
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 703 1092 3.0E-10
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 804 1089 3.0E-10
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 768 952 3.0E-10
sp|O43300|LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens GN=LRRTM2 PE=2 SV=3 800 1004 3.0E-10
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 725 933 3.0E-10
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 1452 1703 3.0E-10
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 990 1334 4.0E-10
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 876 1322 4.0E-10
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 799 1085 4.0E-10
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 754 1099 4.0E-10
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 793 1085 4.0E-10
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 734 1090 4.0E-10
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 805 1032 4.0E-10
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 734 931 4.0E-10
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 727 905 4.0E-10
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 1543 1687 4.0E-10
sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=2 SV=1 868 1085 4.0E-10
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 725 930 4.0E-10
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 730 943 5.0E-10
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 834 1089 5.0E-10
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 772 1000 5.0E-10
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 729 1091 5.0E-10
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 734 1063 5.0E-10
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 734 904 5.0E-10
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 1544 1702 5.0E-10
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 806 1088 5.0E-10
sp|Q8BGA3|LRRT2_MOUSE Leucine-rich repeat transmembrane neuronal protein 2 OS=Mus musculus GN=Lrrtm2 PE=2 SV=1 800 1032 5.0E-10
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 784 1004 5.0E-10
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 852 1086 6.0E-10
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 828 1066 6.0E-10
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 762 1037 6.0E-10
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 940 1096 6.0E-10
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 837 1089 6.0E-10
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 1549 1669 6.0E-10
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 715 988 6.0E-10
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 731 906 7.0E-10
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 1429 1709 7.0E-10
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 788 1089 7.0E-10
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 755 1083 7.0E-10
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 1427 1703 7.0E-10
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 961 1090 8.0E-10
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 780 949 8.0E-10
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 789 1036 8.0E-10
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 1427 1703 8.0E-10
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 731 1094 8.0E-10
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 773 1047 9.0E-10
sp|D4AC13|LGR5_RAT Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Rattus norvegicus GN=Lgr5 PE=3 SV=1 720 1065 9.0E-10
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 789 1036 9.0E-10
sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 720 1065 9.0E-10
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 778 1069 9.0E-10
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 855 1090 1.0E-09
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 724 930 1.0E-09
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 857 1093 1.0E-09
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 897 1096 1.0E-09
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 839 1067 1.0E-09
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 850 1070 1.0E-09
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 736 1045 1.0E-09
sp|Q6UY18|LIGO4_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 OS=Homo sapiens GN=LINGO4 PE=2 SV=1 804 1085 1.0E-09
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 709 1083 1.0E-09
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 744 1068 1.0E-09
sp|Q66HD6|LRC18_RAT Leucine-rich repeat-containing protein 18 OS=Rattus norvegicus GN=Lrrc18 PE=2 SV=1 734 904 1.0E-09
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 865 1089 1.0E-09
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 1456 1714 1.0E-09
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 867 1334 2.0E-09
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 716 1062 2.0E-09
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 749 907 2.0E-09
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 852 1089 2.0E-09
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 770 944 2.0E-09
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 743 1091 2.0E-09
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 725 933 2.0E-09
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 773 1047 2.0E-09
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 708 1093 2.0E-09
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 755 1037 2.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 751 1083 2.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 750 1063 2.0E-09
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 734 949 2.0E-09
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 767 994 2.0E-09
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 1545 1658 2.0E-09
sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=1 SV=1 715 988 2.0E-09
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 736 1075 2.0E-09
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 849 1067 2.0E-09
sp|Q9N008|LIGO1_MACFA Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Macaca fascicularis GN=LINGO1 PE=2 SV=1 804 1085 2.0E-09
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 977 1090 2.0E-09
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 731 914 2.0E-09
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 1461 1709 2.0E-09
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 777 1094 2.0E-09
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 1427 1703 2.0E-09
sp|Q5RDJ4|LIGO1_PONAB Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Pongo abelii GN=LINGO1 PE=2 SV=1 804 1085 2.0E-09
sp|Q96FE5|LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens GN=LINGO1 PE=1 SV=2 804 1085 2.0E-09
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 1545 1702 2.0E-09
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 732 1089 2.0E-09
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 1407 1702 2.0E-09
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 720 911 3.0E-09
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 725 1068 3.0E-09
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 818 966 3.0E-09
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 782 1089 3.0E-09
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 755 1083 3.0E-09
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 734 949 3.0E-09
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 1427 1703 3.0E-09
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 849 1067 3.0E-09
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 734 930 3.0E-09
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 731 1040 3.0E-09
sp|A4IIW9|LIGO1_XENTR Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Xenopus tropicalis GN=lingo1 PE=2 SV=1 804 1065 3.0E-09
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 725 932 4.0E-09
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 709 1095 4.0E-09
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 773 1024 4.0E-09
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 983 1089 4.0E-09
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 729 1063 4.0E-09
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 792 932 4.0E-09
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 1427 1703 4.0E-09
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 1536 1684 4.0E-09
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 754 898 4.0E-09
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 784 953 4.0E-09
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 720 1065 4.0E-09
sp|O94294|SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sog2 PE=1 SV=1 805 930 4.0E-09
sp|P51886|LUM_RAT Lumican OS=Rattus norvegicus GN=Lum PE=1 SV=1 777 973 4.0E-09
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 779 1089 5.0E-09
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 734 1083 5.0E-09
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 961 1089 5.0E-09
sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=2 SV=1 723 1069 5.0E-09
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 1437 1709 5.0E-09
sp|Q9NT99|LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens GN=LRRC4B PE=2 SV=3 718 985 5.0E-09
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 1548 1695 5.0E-09
sp|P51885|LUM_MOUSE Lumican OS=Mus musculus GN=Lum PE=1 SV=2 777 973 5.0E-09
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 920 1090 6.0E-09
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 898 1097 6.0E-09
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 786 942 6.0E-09
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 889 1089 6.0E-09
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 823 949 6.0E-09
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 768 1000 6.0E-09
sp|Q05443|LUM_BOVIN Lumican OS=Bos taurus GN=LUM PE=1 SV=1 802 1046 6.0E-09
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 724 938 6.0E-09
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 875 1089 6.0E-09
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 849 1085 6.0E-09
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 1548 1695 6.0E-09
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 1548 1695 6.0E-09
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 734 904 7.0E-09
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 715 920 7.0E-09
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 737 943 7.0E-09
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 725 1068 7.0E-09
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 725 1066 7.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 848 1085 7.0E-09
sp|D4A7P2|LRRT2_RAT Leucine-rich repeat transmembrane neuronal protein 2 OS=Rattus norvegicus GN=Lrrtm2 PE=1 SV=1 800 1001 7.0E-09
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 776 1063 7.0E-09
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 1548 1695 7.0E-09
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 876 1102 8.0E-09
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 747 1083 8.0E-09
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 828 1090 8.0E-09
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 725 1062 8.0E-09
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 875 1089 8.0E-09
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 1548 1695 8.0E-09
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 783 944 9.0E-09
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 793 1070 9.0E-09
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 731 1069 9.0E-09
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 1401 1721 9.0E-09
sp|P0C192|LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus GN=Lrrc4b PE=1 SV=1 726 985 9.0E-09
sp|Q9D1T0|LIGO1_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Mus musculus GN=Lingo1 PE=1 SV=1 804 1085 9.0E-09
sp|Q5Z9N5|FON1_ORYSJ Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 OS=Oryza sativa subsp. japonica GN=FON1 PE=1 SV=1 829 1096 9.0E-09
sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 868 1085 9.0E-09
sp|P0CC10|LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus GN=Lrrc4b PE=1 SV=1 726 985 9.0E-09
sp|Q6NWG1|LRC59_DANRE Leucine-rich repeat-containing protein 59 OS=Danio rerio GN=lrrc59 PE=2 SV=1 828 929 9.0E-09
sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 873 1089 9.0E-09
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 716 1068 1.0E-08
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 885 1093 1.0E-08
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 796 1085 1.0E-08
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 983 1089 1.0E-08
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 982 1089 1.0E-08
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 727 929 1.0E-08
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 773 949 1.0E-08
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 772 1085 1.0E-08
sp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 OS=Arabidopsis thaliana GN=PXC3 PE=2 SV=1 749 929 1.0E-08
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 734 1043 1.0E-08
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 774 922 1.0E-08
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 771 1062 1.0E-08
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 907 1069 1.0E-08
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 849 1085 1.0E-08
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 1550 1705 1.0E-08
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 717 1092 1.0E-08
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 725 954 1.0E-08
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 797 932 1.0E-08
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 732 1037 1.0E-08
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 1550 1705 1.0E-08
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1399 1690 1.0E-08
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 791 1083 1.0E-08
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 740 1113 1.0E-08
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 986 1090 1.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 860 1086 2.0E-08
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 724 1078 2.0E-08
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 1009 1089 2.0E-08
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 839 1336 2.0E-08
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 734 971 2.0E-08
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 749 1069 2.0E-08
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 754 1083 2.0E-08
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 731 914 2.0E-08
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 754 1126 2.0E-08
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 907 1069 2.0E-08
sp|Q6P3Y9|PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus GN=Podnl1 PE=2 SV=2 725 1069 2.0E-08
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 716 971 2.0E-08
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 1550 1705 2.0E-08
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 823 974 2.0E-08
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 745 954 2.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 731 914 2.0E-08
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 724 892 3.0E-08
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 867 1094 3.0E-08
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 947 1089 3.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 909 1118 3.0E-08
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 736 971 3.0E-08
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 743 1053 3.0E-08
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 779 1066 3.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 928 1088 3.0E-08
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 750 986 3.0E-08
sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 883 1089 3.0E-08
sp|Q149C3|LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus GN=Lingo4 PE=2 SV=2 804 1085 3.0E-08
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 875 1089 3.0E-08
sp|Q68CR7|LRC66_HUMAN Leucine-rich repeat-containing protein 66 OS=Homo sapiens GN=LRRC66 PE=2 SV=1 759 949 3.0E-08
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 849 1085 3.0E-08
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 875 1089 3.0E-08
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 798 1039 3.0E-08
sp|Q9CAJ0|P2C16_ARATH Protein phosphatase 2C 16 OS=Arabidopsis thaliana GN=HAB1 PE=1 SV=1 1456 1678 3.0E-08
sp|Q6NUI6|CHADL_HUMAN Chondroadherin-like protein OS=Homo sapiens GN=CHADL PE=1 SV=2 733 1044 3.0E-08
sp|Q6EMK4|VASN_HUMAN Vasorin OS=Homo sapiens GN=VASN PE=1 SV=1 725 964 3.0E-08
sp|Q9IB75|PGS1_XENLA Biglycan OS=Xenopus laevis GN=bgn PE=2 SV=1 778 1065 3.0E-08
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 898 1097 4.0E-08
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 961 1097 4.0E-08
sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 729 1069 4.0E-08
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 982 1105 4.0E-08
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 849 1085 4.0E-08
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 993 1090 4.0E-08
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 725 944 5.0E-08
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 779 1092 5.0E-08
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 961 1096 5.0E-08
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 731 905 5.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 836 1046 5.0E-08
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 965 1089 5.0E-08
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 789 1092 5.0E-08
sp|Q96L50|LLR1_HUMAN Leucine-rich repeat protein 1 OS=Homo sapiens GN=LRR1 PE=1 SV=2 777 924 5.0E-08
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 754 896 5.0E-08
sp|Q4WQG5|CCR4_ASPFU Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccr4 PE=3 SV=1 993 1090 5.0E-08
sp|P51884|LUM_HUMAN Lumican OS=Homo sapiens GN=LUM PE=1 SV=2 802 1046 5.0E-08
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 957 1360 6.0E-08
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 965 1089 6.0E-08
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 735 939 6.0E-08
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 725 1093 6.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 861 1089 6.0E-08
sp|Q2UUI3|CCR4_ASPOR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ccr4 PE=3 SV=1 1006 1090 6.0E-08
sp|Q9SSD1|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=1 SV=1 786 951 6.0E-08
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 947 1089 7.0E-08
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 887 1089 7.0E-08
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 703 956 7.0E-08
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 980 1105 7.0E-08
sp|P49598|P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1 1430 1671 7.0E-08
sp|Q6PEZ8|PONL1_HUMAN Podocan-like protein 1 OS=Homo sapiens GN=PODNL1 PE=2 SV=2 775 1069 7.0E-08
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 1459 1715 7.0E-08
sp|P70193|LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus GN=Lrig1 PE=2 SV=2 734 1021 7.0E-08
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 778 940 8.0E-08
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 782 1069 8.0E-08
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 731 905 8.0E-08
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 762 1039 8.0E-08
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 779 971 8.0E-08
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 885 1083 8.0E-08
sp|Q6NUI6|CHADL_HUMAN Chondroadherin-like protein OS=Homo sapiens GN=CHADL PE=1 SV=2 734 971 8.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 887 1094 9.0E-08
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 982 1090 9.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 767 1089 9.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 928 1085 9.0E-08
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 725 1089 9.0E-08
sp|O75325|LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens GN=LRRN2 PE=2 SV=2 785 1073 9.0E-08
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 804 1043 9.0E-08
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 867 1097 1.0E-07
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 983 1089 1.0E-07
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 733 1092 1.0E-07
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 868 1085 1.0E-07
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 965 1089 1.0E-07
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 889 1069 1.0E-07
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 731 905 1.0E-07
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 778 1085 1.0E-07
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 851 1079 1.0E-07
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 889 1089 1.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 909 1066 1.0E-07
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 908 1069 1.0E-07
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 779 932 1.0E-07
sp|Q5FW85|ECM2_MOUSE Extracellular matrix protein 2 OS=Mus musculus GN=Ecm2 PE=1 SV=1 714 1051 1.0E-07
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 755 1086 1.0E-07
sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 814 1067 1.0E-07
sp|A6H694|LRC63_MOUSE Leucine-rich repeat-containing protein 63 OS=Mus musculus GN=Lrrc63 PE=2 SV=1 983 1089 1.0E-07
sp|Q3ZBN5|ASPN_BOVIN Asporin OS=Bos taurus GN=ASPN PE=2 SV=1 769 1065 1.0E-07
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 735 1088 2.0E-07
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 961 1164 2.0E-07
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 909 1089 2.0E-07
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 822 1286 2.0E-07
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 763 1085 2.0E-07
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 750 1083 2.0E-07
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 982 1090 2.0E-07
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 868 1085 2.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 833 1023 2.0E-07
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 805 1069 2.0E-07
sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 725 930 2.0E-07
sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 773 956 2.0E-07
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 721 1068 2.0E-07
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 736 1044 2.0E-07
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 1429 1673 2.0E-07
sp|A1CIJ6|CCR4_ASPCL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccr4 PE=3 SV=1 993 1090 2.0E-07
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 1547 1704 2.0E-07
sp|Q14392|LRC32_HUMAN Leucine-rich repeat-containing protein 32 OS=Homo sapiens GN=LRRC32 PE=1 SV=1 731 1066 2.0E-07
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 957 1432 3.0E-07
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 947 1089 3.0E-07
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 779 1086 3.0E-07
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 898 1097 3.0E-07
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 730 932 3.0E-07
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 782 1069 3.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 818 973 3.0E-07
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 722 1068 3.0E-07
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 746 1083 3.0E-07
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 823 949 3.0E-07
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 907 1069 3.0E-07
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 958 1089 3.0E-07
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 983 1089 3.0E-07
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 893 1069 3.0E-07
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 907 1069 3.0E-07
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 907 1069 3.0E-07
sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 725 1012 3.0E-07
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 721 1068 3.0E-07
sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 734 949 3.0E-07
sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 725 1085 3.0E-07
sp|Q6ZNQ3|LRC69_HUMAN Leucine-rich repeat-containing protein 69 OS=Homo sapiens GN=LRRC69 PE=2 SV=2 829 1066 3.0E-07
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 1459 1659 3.0E-07
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 1457 1671 3.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 957 1089 4.0E-07
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 716 1016 4.0E-07
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 773 1094 4.0E-07
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 782 1069 4.0E-07
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 894 1094 4.0E-07
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 754 932 4.0E-07
sp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 OS=Arabidopsis thaliana GN=PXC3 PE=2 SV=1 714 1095 4.0E-07
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 811 974 4.0E-07
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 775 1089 4.0E-07
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 900 1069 4.0E-07
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 779 932 4.0E-07
sp|A6H694|LRC63_MOUSE Leucine-rich repeat-containing protein 63 OS=Mus musculus GN=Lrrc63 PE=2 SV=1 851 993 4.0E-07
sp|A6H694|LRC63_MOUSE Leucine-rich repeat-containing protein 63 OS=Mus musculus GN=Lrrc63 PE=2 SV=1 799 920 4.0E-07
sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 727 1156 4.0E-07
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 732 1089 4.0E-07
sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=2 SV=2 773 993 4.0E-07
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 1548 1684 4.0E-07
sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 870 1089 4.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 902 1090 4.0E-07
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 1549 1659 4.0E-07
sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=2 721 1068 4.0E-07
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 1549 1659 4.0E-07
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 875 1093 5.0E-07
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 794 965 5.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 982 1089 5.0E-07
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 779 932 5.0E-07
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 871 1070 5.0E-07
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 749 929 5.0E-07
sp|P51886|LUM_RAT Lumican OS=Rattus norvegicus GN=Lum PE=1 SV=1 802 1046 5.0E-07
sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 713 1015 5.0E-07
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 984 1088 5.0E-07
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 779 932 6.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 798 958 6.0E-07
sp|Q5E9X4|LRC59_BOVIN Leucine-rich repeat-containing protein 59 OS=Bos taurus GN=LRRC59 PE=2 SV=1 852 932 6.0E-07
sp|Q96AG4|LRC59_HUMAN Leucine-rich repeat-containing protein 59 OS=Homo sapiens GN=LRRC59 PE=1 SV=1 852 932 6.0E-07
sp|Q9GKN8|PRELP_BOVIN Prolargin OS=Bos taurus GN=PRELP PE=2 SV=1 789 1042 6.0E-07
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 1437 1723 6.0E-07
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 971 1089 7.0E-07
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 1003 1090 7.0E-07
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 779 932 7.0E-07
sp|P51885|LUM_MOUSE Lumican OS=Mus musculus GN=Lum PE=1 SV=2 802 1046 7.0E-07
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 1006 1090 7.0E-07
sp|Q05C16|LRC63_HUMAN Leucine-rich repeat-containing protein 63 OS=Homo sapiens GN=LRRC63 PE=2 SV=2 724 906 7.0E-07
sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=2 SV=1 870 1085 7.0E-07
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 1445 1701 8.0E-07
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 779 1063 9.0E-07
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 820 1083 9.0E-07
sp|Q6P3Y9|PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus GN=Podnl1 PE=2 SV=2 768 1309 9.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 741 930 9.0E-07
sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=2 SV=1 725 1083 9.0E-07
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 747 1083 1.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 699 904 1.0E-06
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 983 1089 1.0E-06
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 920 1089 1.0E-06
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 767 929 1.0E-06
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 734 954 1.0E-06
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 771 1109 1.0E-06
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 777 954 1.0E-06
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 735 1117 1.0E-06
sp|E9Q7T7|CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus GN=Chadl PE=1 SV=1 734 971 1.0E-06
sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2 734 929 1.0E-06
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 822 973 1.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 779 932 1.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 907 1090 1.0E-06
sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 773 1060 1.0E-06
sp|Q6NX28|LRC59_XENTR Leucine-rich repeat-containing protein 59 OS=Xenopus tropicalis GN=lrrc59 PE=2 SV=1 851 929 1.0E-06
sp|O46403|PGS1_HORSE Biglycan OS=Equus caballus GN=BGN PE=2 SV=1 778 1085 1.0E-06
sp|Q5RJR8|LRC59_RAT Leucine-rich repeat-containing protein 59 OS=Rattus norvegicus GN=Lrrc59 PE=1 SV=1 852 932 1.0E-06
sp|P21810|PGS1_HUMAN Biglycan OS=Homo sapiens GN=BGN PE=1 SV=2 778 1065 1.0E-06
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 1536 1702 1.0E-06
sp|Q922Q8|LRC59_MOUSE Leucine-rich repeat-containing protein 59 OS=Mus musculus GN=Lrrc59 PE=1 SV=1 852 932 1.0E-06
sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 744 913 1.0E-06
sp|Q06828|FMOD_HUMAN Fibromodulin OS=Homo sapiens GN=FMOD PE=1 SV=2 769 1064 1.0E-06
sp|Q0P5X1|LRIQ1_MOUSE Leucine-rich repeat and IQ domain-containing protein 1 OS=Mus musculus GN=Lrriq1 PE=2 SV=2 891 1073 1.0E-06
sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 758 970 1.0E-06
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 731 929 1.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 758 911 2.0E-06
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 720 1060 2.0E-06
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 820 965 2.0E-06
sp|O93233|PLIB_GLOBS Phospholipase A2 inhibitor OS=Gloydius brevicaudus siniticus PE=1 SV=1 725 883 2.0E-06
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 749 1091 2.0E-06
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 983 1069 2.0E-06
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 714 903 2.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 771 951 2.0E-06
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 748 1047 2.0E-06
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 923 1069 2.0E-06
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 736 1037 2.0E-06
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 818 932 2.0E-06
sp|P70193|LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus GN=Lrig1 PE=2 SV=2 734 1039 2.0E-06
sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 709 1085 2.0E-06
sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 800 1446 2.0E-06
sp|O46390|PGS1_SHEEP Biglycan OS=Ovis aries GN=BGN PE=2 SV=1 778 1085 2.0E-06
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 993 1085 2.0E-06
sp|Q50L44|LIGO1_CHICK Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Gallus gallus GN=LINGO1 PE=2 SV=1 805 1065 2.0E-06
sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens GN=PPP1R7 PE=1 SV=1 757 973 2.0E-06
sp|Q5HZV9|PP1R7_RAT Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus GN=Ppp1r7 PE=1 SV=1 757 973 2.0E-06
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 788 1065 2.0E-06
sp|P22194|SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds22 PE=1 SV=2 795 1056 2.0E-06
sp|P45969|SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans GN=sds-22 PE=3 SV=1 779 986 2.0E-06
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 725 950 2.0E-06
sp|P47853|PGS1_RAT Biglycan OS=Rattus norvegicus GN=Bgn PE=2 SV=1 778 1085 2.0E-06
sp|P28653|PGS1_MOUSE Biglycan OS=Mus musculus GN=Bgn PE=1 SV=1 778 1085 2.0E-06
sp|Q8SU52|CCR4_ENCCU Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCR4 PE=3 SV=1 798 906 2.0E-06
sp|P21809|PGS1_BOVIN Biglycan OS=Bos taurus GN=BGN PE=1 SV=3 778 1085 2.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 721 1068 2.0E-06
sp|P35409|GLHR_ANTEL Probable glycoprotein hormone G-protein coupled receptor OS=Anthopleura elegantissima PE=2 SV=1 754 937 2.0E-06
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 851 927 2.0E-06
sp|Q7L0X0|TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens GN=TRIL PE=1 SV=2 715 988 2.0E-06
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 983 1090 3.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 709 897 3.0E-06
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 983 1090 3.0E-06
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 785 912 3.0E-06
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 844 1136 3.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 773 932 3.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 716 1060 3.0E-06
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 705 1060 3.0E-06
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 776 1067 3.0E-06
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 907 1090 3.0E-06
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 761 1091 3.0E-06
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 725 1037 3.0E-06
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 828 1066 3.0E-06
sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 750 971 3.0E-06
sp|Q6AXL3|NRROS_DANRE Negative regulator of reactive oxygen species OS=Danio rerio GN=nrros PE=2 SV=1 705 1022 3.0E-06
sp|B0BLW3|LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis GN=lgr4 PE=1 SV=1 723 1089 3.0E-06
sp|O80492|P2C05_ARATH Probable protein phosphatase 2C 5 OS=Arabidopsis thaliana GN=At1g09160 PE=2 SV=1 1548 1677 3.0E-06
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 789 1092 3.0E-06
sp|Q80ZD9|AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus GN=Amigo2 PE=1 SV=1 734 892 3.0E-06
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 730 904 4.0E-06
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 722 1068 4.0E-06
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 983 1089 4.0E-06
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 735 906 4.0E-06
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 875 1066 4.0E-06
sp|Q9DE66|KERA_COTJA Keratocan OS=Coturnix coturnix japonica GN=KERA PE=2 SV=1 786 1067 4.0E-06
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 744 905 4.0E-06
sp|Q9C2R2|CCR4_NEUCR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccr4 PE=3 SV=2 788 905 4.0E-06
sp|Q9LFG1|Y3359_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590 OS=Arabidopsis thaliana GN=At3g53590 PE=3 SV=2 885 1085 4.0E-06
sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 827 1086 4.0E-06
sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 813 922 4.0E-06
sp|Q3URE9|LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus GN=Lingo2 PE=2 SV=1 805 1098 4.0E-06
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 725 907 5.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 755 903 5.0E-06
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 983 1069 5.0E-06
sp|Q99MQ4|ASPN_MOUSE Asporin OS=Mus musculus GN=Aspn PE=1 SV=1 734 952 5.0E-06
sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 757 973 5.0E-06
sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus GN=DCN PE=1 SV=2 778 1091 5.0E-06
sp|O42235|KERA_CHICK Keratocan OS=Gallus gallus GN=KERA PE=1 SV=1 786 1067 5.0E-06
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 990 1090 6.0E-06
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 734 920 6.0E-06
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 784 959 6.0E-06
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 805 1081 6.0E-06
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 773 1085 6.0E-06
sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 757 973 6.0E-06
sp|Q9BXN1|ASPN_HUMAN Asporin OS=Homo sapiens GN=ASPN PE=1 SV=2 778 1065 6.0E-06
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 983 1090 7.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 882 1070 7.0E-06
sp|Q5Z9N5|FON1_ORYSJ Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 OS=Oryza sativa subsp. japonica GN=FON1 PE=1 SV=1 792 1083 7.0E-06
sp|Q5Z9N5|FON1_ORYSJ Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 OS=Oryza sativa subsp. japonica GN=FON1 PE=1 SV=1 724 930 7.0E-06
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 731 1060 7.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 734 889 7.0E-06
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 845 1064 8.0E-06
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 725 927 8.0E-06
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 869 1070 8.0E-06
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 795 1075 8.0E-06
sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 780 1097 8.0E-06
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 898 1066 9.0E-06
sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=1 SV=1 776 1067 9.0E-06
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 898 1066 9.0E-06
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 779 932 9.0E-06
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 747 1043 9.0E-06
sp|Q6R5N8|TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus GN=Tlr13 PE=1 SV=1 782 1118 9.0E-06
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 802 930 9.0E-06
sp|C0LGU1|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1 778 1070 1.0E-05
sp|Q7L985|LIGO2_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Homo sapiens GN=LINGO2 PE=2 SV=1 805 1098 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0009190 cyclic nucleotide biosynthetic process Yes
GO:0005515 protein binding Yes
GO:0006171 cAMP biosynthetic process Yes
GO:0035556 intracellular signal transduction Yes
GO:0000287 magnesium ion binding Yes
GO:0004016 adenylate cyclase activity Yes
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016791 phosphatase activity No
GO:0016829 lyase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0009187 cyclic nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009260 ribonucleotide biosynthetic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0009259 ribonucleotide metabolic process No
GO:0009058 biosynthetic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0007165 signal transduction No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0046872 metal ion binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0016787 hydrolase activity No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0043169 cation binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0046058 cAMP metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0052652 cyclic purine nucleotide metabolic process No
GO:0016849 phosphorus-oxygen lyase activity No
GO:0065007 biological regulation No
GO:0006807 nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0009117 nucleotide metabolic process No
GO:0009975 cyclase activity No
GO:0018130 heterocycle biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:1901135 carbohydrate derivative metabolic process No
GO:0043167 ion binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3188
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1247
Ophiocordyceps australis map64 (Brazil) OphauB2|2246
Ophiocordyceps camponoti-floridani Ophcf2|05104
Ophiocordyceps camponoti-rufipedis Ophun1|6019 (this protein)
Ophiocordyceps kimflemingae Ophio5|2774
Ophiocordyceps subramaniannii Hirsu2|5721

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6019
MSDNAAARFSSLTSASNSTDGSSRTLKPATPPPLAPSSSTSSLSASPSARHIHRAHRDLDASPDLRPKPPPHDDA
YVAAPRGSQSSMANGSGRRDGAAPDASRANSMVAPWASSTPPPPPPKGPLNATSHDDSSDGTSAVSQFSTALGLS
GLRHGAVPPDIPESPDTSYFPVDARRPSLASITTASSQGSRTSGTRGGYRKLQGFFGEEFPGRDSSETSLTASVV
GKDQRARSYSHTRPSQRDRNFSNATDPRDASPSSSRPRTPVPSSQVVPFLYQDNNDIARYGEAPIRDIMAGPDRE
RYEASSPAPLIPPKTLTSSRSANPLAHLPGHHRHHRSNEDPRGTPRPSTSRDPSHAAATTPSLRERGSSVNMPGQ
RARAQSPAAPGGNGASKAGASDPPTSPVKRGFLGRLRRNKDKDRDRDRDRDNRDRDYRARDEGVSANSRDLPQPA
RPLQAKASKTDFSRPALSPPQAQGHWPGAVDAASRGQSFNKFPFTRNKTRPSQRNDLGDEAIGPTDPQQRSEPPD
SSVFHLDTDLNDMEGILQPPATVVPTDAPAPNNPDGERKDSAIEQPKGGWDAPDSWAVRRDTEDASIVYDLDETE
ESPRPEEKLAPYFIRIFRSDGTFSTHSMPLDSSSSDVISQVVKKTYVLDGLENYHIILKKHDLIRVLTAADRPLL
LQKRLLQQVGYEEKDRIEDLGREDNGYLCRFMFLSARESDFHAKTNDLGFSRSQKINHVDLSGRNLVTIPISLYS
KAADITSLNLSRNLSLDVPRDFIQSCKHLRDIKFTNNEVRKLPVSLSRASRLTFLDVSNNRLEQLENAELNSLTG
LLKMNLANNRLTRLPAYFDAYQALRSLNISSNFLDAFPPFLCQLRSLVDLDMSFNAIARLPEEIGNLKNLEKFLI
TNNKLTDEVPAGFRGLTSLRELDIKFNAMTSIDIISELPKLEILCAAHNNVSSFSGKFECIRQLKLNSNPLNKFE
FTEPVPTLTTLNLSHAQLVSIDSAFVHMMNLERLVLDRNHFVTIPQQIGILSRLEHFSVANNAVAELPPQIGCLA
ELQVLDVRGNNISKLPPEIWWANKLETFNASSNVLDSFPKPSSKPPRAPGGGTGAGNGGDESASVPAGPPPTQNG
KLQAPTALTAAPSSEELSEERRPSQGSSTLLSVGPSPVQAAADRKGSVVSVYGKGGRKTSVVSRAASSQAGSTSS
GVTAPTNPRKDSGVSSKLTTTFAGSLRNLYLADNRLEDDVFDQITLLSELRVLNLSYNEEITDMPQRSIRSWPQL
VELYLSGNGLTSIPADDLEETSLLQTLCINGNRFTNLPADISRAKKLAVFDCGNNFLKYNICNVPYDWNWNLNPN
LRYLNLSGNKRLEIKQTGGGGGGDGHGAGNREQYTDFNRLSNLRVLGLMDVTLTQPSIPDQSEDRRVRTSGSLAG
HLPYGMADTLGKNEHLSTVDLVVPRFNSSETEMLLGLFDGQALSSGGSKIAKYLHENFGHIFAMELKGLKTRQNE
TPVDALRRAFLALNKDLVTIAVQPQHAEERPKTRGTAQPVVLSREDLNSGGVATVVYFQGTDLYVANVGDAQAMV
IQMDGTHQMLTRKHDPAEASERSRIRDAGGWVSRNGRLNDLLQVSRAFGYVDLMPAVQAAPHVSSMKMGDKEDII
LLATSELWEYLAPGLITDIARAERRDLMRAAQKLRDLAVAYGASGKIMVMMISVADLKRRMERSRMHRGASMSLY
PSGVPDEAQALSTTRRGRKAKGDVLDSSLGRLEAEIPAPTGNVSIVFTDIKNSTNLWEMYPSAMRSAIKLHNEVM
RRQLRRIGGYEVKTEGDAFMVSFPTATSALLWCFAVQLSLLDVNWPSEILSSMSGQSVFDKDNNVIFKGLSVRMG
IHFGDCVSETDPVTRRMDYFGPMVNKAARVSAVADGGQITVSTDFISEIQRCLETHSADRAGSVTTVDDDVDDDL
SHAAAIRKDLAALTSQGFEVKEMGEKKLKGLENPEMMYSLYPHGLAGRVEYHLRHERREAAAAAGVAVEEPRPAG
PGPELSFDPDTLWALWSVSLRLEMLCSSLEKDNADGAALCQPETGVLDRMKARTHDVTDQFLINFAEHQVSRIET
CISTLAMRHLAVGGGPLKELADLRAPMDSILEFFVQQKKELDLYRKTFGSLHRTDDAAAAEVEELDGDEEEVEGE
TD*
Coding >Ophun1|6019
ATGTCGGACAATGCGGCCGCCCGCTTCAGCTCCCTCACGAGCGCAAGCAACAGCACAGACGGCAGCTCGCGCACC
CTCAAGCCTGCGACTCCGCCTCCGCTGGCTCCCTCGTCGTCGACCTCATCATTGTCGGCTTCGCCATCCGCTCGG
CATATACACCGTGCCCATCGCGATCTCGACGCCAGTCCCGACCTTCGGCCCAAGCCGCCGCCTCACGACGATGCC
TACGTCGCCGCCCCTCGCGGCTCGCAATCGTCCATGGCCAATGGCAGCGGTCGCCGTGACGGTGCCGCCCCCGAC
GCTTCTCGCGCCAACTCAATGGTCGCCCCTTGGGCTTCCAGCACGCCGCCGCCTCCTCCTCCAAAGGGTCCGCTG
AACGCGACTTCACACGACGACTCCAGCGATGGCACCTCGGCCGTATCGCAGTTCTCCACGGCCCTGGGCCTCTCC
GGCCTCCGCCACGGCGCCGTGCCCCCGGATATCCCCGAGTCCCCCGACACGTCCTACTTCCCCGTCGACGCTCGC
CGGCCGTCGCTCGCCAGCATCACAACGGCCAGTAGTCAGGGGTCCAGAACTAGCGGCACGCGCGGCGGCTACCGC
AAGCTCCAAGGCTTCTTTGGCGAAGAGTTTCCCGGGCGCGATAGCTCCGAAACTAGCCTGACCGCATCCGTCGTC
GGCAAGGACCAGCGCGCCCGATCTTACAGCCACACCCGCCCCTCCCAGCGAGACCGCAACTTCTCCAATGCCACT
GATCCGAGAGACGCCTCGCCTTCCTCATCTCGCCCGAGGACCCCCGTGCCCTCATCTCAGGTCGTCCCCTTTCTC
TACCAGGACAACAACGACATCGCCCGTTACGGGGAGGCGCCCATCAGGGATATTATGGCCGGTCCTGACCGAGAG
CGATACGAAGCCTCGTCTCCCGCGCCCCTGATTCCCCCAAAGACCTTGACCTCGTCCCGGTCTGCGAACCCTCTG
GCTCACCTCCCCGGCCATCACCGGCACCACCGGAGCAACGAGGACCCGAGAGGCACCCCCCGGCCTTCCACCAGC
CGGGACCCATCCCACGCCGCGGCCACGACGCCCAGCCTTCGCGAACGCGGTTCCTCGGTCAACATGCCCGGCCAG
AGAGCGAGGGCCCAGAGCCCGGCGGCGCCCGGCGGCAACGGAGCCTCCAAAGCCGGCGCCTCCGACCCGCCGACG
TCGCCCGTCAAGAGAGGCTTCCTCGGTCGCCTCCGCCGTAACAAGGACAAGGATAGGGACAGGGACAGGGATAGG
GATAATAGGGATAGGGACTACCGAGCCCGAGATGAAGGCGTTTCCGCCAATTCTCGCGATCTCCCCCAGCCCGCT
CGCCCTCTCCAGGCCAAGGCTTCCAAGACGGACTTCTCCAGGCCGGCCCTGTCTCCGCCTCAGGCTCAGGGGCAC
TGGCCCGGGGCCGTCGATGCCGCCTCCCGCGGACAGTCGTTCAACAAGTTCCCCTTCACCAGGAATAAGACGCGT
CCCAGCCAGCGCAATGACTTGGGCGACGAGGCCATCGGCCCTACGGACCCTCAGCAGCGCAGCGAGCCCCCCGAC
AGCAGCGTCTTCCACCTCGACACCGACCTCAACGACATGGAGGGCATCTTGCAGCCGCCTGCCACCGTCGTGCCT
ACTGACGCGCCCGCCCCCAACAACCCCGACGGCGAGCGGAAGGACTCGGCCATCGAGCAGCCCAAGGGCGGCTGG
GATGCGCCCGACAGTTGGGCCGTCCGCCGCGACACCGAGGACGCGTCCATCGTCTACGACTTGGATGAGACGGAG
GAGTCGCCTCGGCCCGAGGAGAAACTGGCCCCCTACTTCATCCGCATCTTCCGCTCCGACGGCACCTTTTCCACT
CACTCGATGCCCCTCGACTCCTCCTCGTCCGACGTCATCTCGCAGGTGGTAAAGAAGACGTACGTCCTGGACGGG
CTAGAGAACTACCACATCATTCTCAAGAAGCACGACCTCATCCGCGTCCTCACGGCCGCCGACAGGCCCCTGCTC
TTGCAGAAGCGTCTGCTGCAACAAGTTGGCTACGAGGAAAAGGACAGGATCGAGGATCTCGGCCGCGAGGACAAT
GGCTACCTCTGCCGATTCATGTTTCTGTCGGCGCGAGAGAGCGACTTTCACGCAAAGACTAATGATCTGGGCTTT
TCGCGCTCTCAGAAGATTAACCACGTCGACCTTTCGGGCCGCAACCTCGTCACCATTCCCATCTCGCTCTACTCC
AAGGCGGCTGACATCACCTCGCTTAACCTGTCGAGGAATCTGTCGCTGGACGTACCTCGAGATTTCATCCAGTCT
TGCAAGCACCTGCGTGACATCAAGTTCACCAACAACGAAGTTCGCAAGCTGCCCGTCAGCCTCAGCCGCGCCAGC
AGGTTGACCTTTCTCGACGTCTCCAACAATCGGCTCGAGCAGCTGGAAAATGCCGAGCTCAACAGCCTCACGGGC
CTGCTCAAGATGAACCTGGCCAACAACCGGTTGACGCGGCTGCCGGCCTACTTTGACGCCTACCAGGCCCTACGG
AGCCTGAACATCTCGTCCAACTTCCTCGACGCCTTCCCGCCCTTTTTGTGCCAGCTGCGGAGCCTCGTGGACCTG
GACATGAGTTTCAACGCCATCGCCCGCCTGCCGGAAGAGATTGGCAACCTCAAGAATCTGGAAAAGTTTCTCATC
ACAAACAACAAGCTCACCGACGAGGTGCCGGCCGGCTTCCGAGGCCTGACGAGTCTGCGCGAGCTCGACATCAAG
TTCAATGCCATGACCAGTATCGACATCATCTCGGAGCTGCCCAAGCTGGAGATTCTGTGCGCGGCTCACAACAAC
GTTTCTTCGTTTTCGGGCAAGTTTGAGTGCATCCGGCAGCTGAAGCTCAACTCGAACCCGCTCAACAAGTTTGAG
TTCACGGAGCCGGTGCCGACGTTGACGACGCTGAACCTGTCGCACGCCCAGTTGGTGAGCATTGACTCGGCCTTT
GTTCACATGATGAACCTGGAGCGACTGGTGCTGGACCGCAACCACTTCGTGACGATACCGCAGCAGATTGGGATT
CTGAGCCGGCTGGAACACTTTAGCGTCGCCAACAACGCCGTGGCCGAGCTGCCGCCGCAGATTGGCTGCCTCGCG
GAGCTGCAAGTGCTGGACGTACGCGGCAACAACATATCGAAGCTGCCGCCCGAGATCTGGTGGGCCAACAAGCTG
GAGACGTTCAACGCGTCGTCCAACGTGCTCGACTCGTTCCCCAAGCCGTCTTCGAAGCCACCGCGAGCTCCCGGA
GGCGGGACCGGTGCCGGCAATGGCGGGGATGAGTCGGCGTCGGTTCCGGCGGGACCGCCTCCGACGCAGAACGGC
AAGCTGCAGGCGCCGACGGCACTGACGGCCGCGCCGAGTTCGGAGGAGTTGTCGGAGGAACGGCGGCCGAGTCAG
GGGTCGAGCACGCTGCTCAGCGTGGGCCCGTCACCGGTACAGGCGGCGGCCGACCGCAAGGGTTCTGTGGTTTCG
GTGTACGGCAAGGGCGGGCGCAAGACGTCGGTGGTATCGCGGGCGGCGTCGTCGCAGGCCGGGTCGACGAGCTCG
GGCGTAACGGCGCCGACGAACCCTAGGAAGGACTCGGGTGTCTCGTCGAAGCTGACGACGACGTTCGCCGGTTCG
TTACGCAACCTGTACCTGGCCGATAACCGGCTCGAGGACGACGTGTTTGACCAGATCACGCTGCTGTCGGAGCTG
CGGGTGCTCAACCTGTCGTACAACGAGGAGATTACCGACATGCCGCAGCGGTCCATCCGCAGCTGGCCGCAGCTG
GTGGAGCTGTATCTGTCCGGCAACGGGTTGACGAGCATCCCGGCCGACGACCTGGAGGAGACGAGTCTGCTGCAG
ACGCTGTGCATCAACGGCAACCGCTTCACCAACCTGCCGGCAGACATCTCGAGGGCCAAGAAGCTGGCCGTGTTT
GACTGCGGCAATAACTTCCTCAAGTACAACATCTGCAATGTTCCCTACGACTGGAACTGGAACCTCAACCCCAAC
CTGCGCTACCTCAACCTGTCTGGCAACAAACGACTGGAGATTAAGCAGACGGGCGGCGGCGGCGGCGGCGATGGC
CACGGAGCCGGCAACCGGGAGCAGTACACCGACTTCAACCGGCTGAGCAACCTGAGGGTGCTGGGCCTCATGGAC
GTGACGCTGACGCAGCCCAGCATCCCCGACCAGAGCGAAGATCGACGCGTGCGCACGTCGGGGTCGCTGGCGGGT
CATCTGCCGTACGGCATGGCGGACACGCTGGGCAAGAATGAGCACCTGTCGACGGTAGACCTGGTGGTCCCGCGC
TTCAACTCGTCCGAGACGGAGATGCTGCTGGGCCTGTTTGACGGCCAGGCTCTGTCAAGCGGCGGCTCCAAGATC
GCCAAGTATCTACACGAGAACTTTGGCCACATCTTTGCCATGGAGCTCAAGGGCCTCAAGACTCGACAGAACGAG
ACGCCGGTGGACGCGCTGAGACGGGCCTTTTTGGCGCTCAACAAGGACCTGGTGACGATTGCGGTACAGCCGCAG
CACGCCGAGGAGCGACCCAAGACGCGAGGGACTGCGCAGCCGGTGGTGCTGAGCCGCGAGGACCTCAACTCGGGC
GGCGTGGCGACGGTTGTTTACTTCCAGGGCACCGACCTGTACGTGGCCAACGTGGGCGACGCGCAGGCCATGGTG
ATTCAGATGGACGGCACTCACCAGATGCTCACTCGCAAGCATGATCCGGCCGAGGCTTCGGAACGGTCCCGGATC
CGCGACGCCGGCGGTTGGGTGTCGCGGAACGGACGGCTCAACGACCTGCTGCAGGTATCGCGGGCCTTTGGCTAC
GTCGACCTGATGCCGGCCGTTCAGGCGGCGCCGCACGTCAGCAGCATGAAGATGGGCGACAAGGAGGACATCATC
CTGCTGGCGACGAGCGAGCTGTGGGAGTATCTGGCTCCGGGCCTCATCACCGACATCGCCCGGGCCGAGCGACGC
GACCTGATGCGGGCGGCCCAGAAGCTTCGCGACCTGGCCGTGGCCTACGGCGCGTCGGGCAAGATCATGGTCATG
ATGATCAGCGTCGCCGACCTCAAGCGGCGCATGGAGCGCTCCCGCATGCACAGGGGCGCCAGCATGTCTCTCTAC
CCTTCGGGCGTCCCCGACGAGGCTCAGGCGCTGTCGACGACGCGCAGGGGTCGCAAGGCCAAGGGCGACGTGCTC
GACTCTTCGCTGGGCCGGCTCGAGGCTGAGATTCCGGCTCCCACGGGCAACGTGTCCATCGTCTTCACCGATATC
AAGAACTCGACCAACCTGTGGGAGATGTATCCGAGCGCCATGCGATCCGCCATCAAGCTGCACAACGAGGTCATG
AGACGTCAGCTGCGACGCATCGGAGGCTACGAGGTCAAGACGGAGGGCGACGCCTTCATGGTGTCGTTCCCCACG
GCCACGTCGGCCCTGCTGTGGTGTTTCGCCGTCCAGTTGTCGCTGCTCGACGTCAACTGGCCGTCGGAGATTCTC
AGCTCCATGTCGGGCCAGTCCGTCTTCGACAAGGACAACAACGTCATCTTCAAGGGCCTGTCGGTTCGCATGGGC
ATTCACTTTGGCGACTGCGTCAGCGAGACGGATCCCGTCACCCGTCGTATGGACTACTTCGGGCCCATGGTCAAC
AAGGCGGCCCGAGTCTCGGCCGTGGCCGACGGCGGTCAGATCACCGTCTCGACCGACTTCATCTCGGAGATCCAG
CGCTGTCTGGAGACGCACTCGGCCGACCGCGCCGGTTCGGTCACTACCGTTGATGATGACGTTGACGACGATCTG
TCTCACGCGGCTGCCATCCGCAAGGACCTGGCTGCCCTCACCTCGCAGGGCTTCGAGGTCAAGGAGATGGGCGAG
AAGAAGCTCAAGGGGCTCGAGAACCCGGAGATGATGTACTCGCTCTACCCTCACGGTCTGGCCGGCCGCGTCGAG
TATCACCTGAGGCACGAGCGCCGCGAGGCCGCCGCAGCCGCCGGAGTGGCCGTCGAGGAGCCGCGTCCGGCCGGC
CCGGGGCCCGAGTTGTCGTTCGACCCGGACACGCTGTGGGCGCTGTGGAGCGTCAGTCTCCGGCTCGAGATGCTG
TGCAGCAGCCTGGAGAAGGACAACGCCGATGGTGCGGCCTTGTGTCAGCCCGAGACGGGGGTGCTGGACCGCATG
AAGGCGAGGACCCACGACGTGACGGATCAGTTTCTGATCAACTTTGCCGAGCACCAAGTGAGCCGGATCGAGACA
TGCATCTCGACGCTCGCCATGCGCCATCTCGCCGTCGGAGGCGGCCCCTTGAAGGAGCTTGCCGACCTGCGAGCG
CCCATGGACTCGATCCTCGAGTTCTTCGTGCAGCAAAAGAAGGAGCTCGACCTTTACCGCAAGACGTTCGGCTCC
CTACACCGGACGGACGACGCCGCGGCCGCCGAGGTGGAGGAGCTGGACGGAGATGAAGAGGAAGTCGAGGGTGAG
ACCGACTGA
Transcript >Ophun1|6019
ATGTCGGACAATGCGGCCGCCCGCTTCAGCTCCCTCACGAGCGCAAGCAACAGCACAGACGGCAGCTCGCGCACC
CTCAAGCCTGCGACTCCGCCTCCGCTGGCTCCCTCGTCGTCGACCTCATCATTGTCGGCTTCGCCATCCGCTCGG
CATATACACCGTGCCCATCGCGATCTCGACGCCAGTCCCGACCTTCGGCCCAAGCCGCCGCCTCACGACGATGCC
TACGTCGCCGCCCCTCGCGGCTCGCAATCGTCCATGGCCAATGGCAGCGGTCGCCGTGACGGTGCCGCCCCCGAC
GCTTCTCGCGCCAACTCAATGGTCGCCCCTTGGGCTTCCAGCACGCCGCCGCCTCCTCCTCCAAAGGGTCCGCTG
AACGCGACTTCACACGACGACTCCAGCGATGGCACCTCGGCCGTATCGCAGTTCTCCACGGCCCTGGGCCTCTCC
GGCCTCCGCCACGGCGCCGTGCCCCCGGATATCCCCGAGTCCCCCGACACGTCCTACTTCCCCGTCGACGCTCGC
CGGCCGTCGCTCGCCAGCATCACAACGGCCAGTAGTCAGGGGTCCAGAACTAGCGGCACGCGCGGCGGCTACCGC
AAGCTCCAAGGCTTCTTTGGCGAAGAGTTTCCCGGGCGCGATAGCTCCGAAACTAGCCTGACCGCATCCGTCGTC
GGCAAGGACCAGCGCGCCCGATCTTACAGCCACACCCGCCCCTCCCAGCGAGACCGCAACTTCTCCAATGCCACT
GATCCGAGAGACGCCTCGCCTTCCTCATCTCGCCCGAGGACCCCCGTGCCCTCATCTCAGGTCGTCCCCTTTCTC
TACCAGGACAACAACGACATCGCCCGTTACGGGGAGGCGCCCATCAGGGATATTATGGCCGGTCCTGACCGAGAG
CGATACGAAGCCTCGTCTCCCGCGCCCCTGATTCCCCCAAAGACCTTGACCTCGTCCCGGTCTGCGAACCCTCTG
GCTCACCTCCCCGGCCATCACCGGCACCACCGGAGCAACGAGGACCCGAGAGGCACCCCCCGGCCTTCCACCAGC
CGGGACCCATCCCACGCCGCGGCCACGACGCCCAGCCTTCGCGAACGCGGTTCCTCGGTCAACATGCCCGGCCAG
AGAGCGAGGGCCCAGAGCCCGGCGGCGCCCGGCGGCAACGGAGCCTCCAAAGCCGGCGCCTCCGACCCGCCGACG
TCGCCCGTCAAGAGAGGCTTCCTCGGTCGCCTCCGCCGTAACAAGGACAAGGATAGGGACAGGGACAGGGATAGG
GATAATAGGGATAGGGACTACCGAGCCCGAGATGAAGGCGTTTCCGCCAATTCTCGCGATCTCCCCCAGCCCGCT
CGCCCTCTCCAGGCCAAGGCTTCCAAGACGGACTTCTCCAGGCCGGCCCTGTCTCCGCCTCAGGCTCAGGGGCAC
TGGCCCGGGGCCGTCGATGCCGCCTCCCGCGGACAGTCGTTCAACAAGTTCCCCTTCACCAGGAATAAGACGCGT
CCCAGCCAGCGCAATGACTTGGGCGACGAGGCCATCGGCCCTACGGACCCTCAGCAGCGCAGCGAGCCCCCCGAC
AGCAGCGTCTTCCACCTCGACACCGACCTCAACGACATGGAGGGCATCTTGCAGCCGCCTGCCACCGTCGTGCCT
ACTGACGCGCCCGCCCCCAACAACCCCGACGGCGAGCGGAAGGACTCGGCCATCGAGCAGCCCAAGGGCGGCTGG
GATGCGCCCGACAGTTGGGCCGTCCGCCGCGACACCGAGGACGCGTCCATCGTCTACGACTTGGATGAGACGGAG
GAGTCGCCTCGGCCCGAGGAGAAACTGGCCCCCTACTTCATCCGCATCTTCCGCTCCGACGGCACCTTTTCCACT
CACTCGATGCCCCTCGACTCCTCCTCGTCCGACGTCATCTCGCAGGTGGTAAAGAAGACGTACGTCCTGGACGGG
CTAGAGAACTACCACATCATTCTCAAGAAGCACGACCTCATCCGCGTCCTCACGGCCGCCGACAGGCCCCTGCTC
TTGCAGAAGCGTCTGCTGCAACAAGTTGGCTACGAGGAAAAGGACAGGATCGAGGATCTCGGCCGCGAGGACAAT
GGCTACCTCTGCCGATTCATGTTTCTGTCGGCGCGAGAGAGCGACTTTCACGCAAAGACTAATGATCTGGGCTTT
TCGCGCTCTCAGAAGATTAACCACGTCGACCTTTCGGGCCGCAACCTCGTCACCATTCCCATCTCGCTCTACTCC
AAGGCGGCTGACATCACCTCGCTTAACCTGTCGAGGAATCTGTCGCTGGACGTACCTCGAGATTTCATCCAGTCT
TGCAAGCACCTGCGTGACATCAAGTTCACCAACAACGAAGTTCGCAAGCTGCCCGTCAGCCTCAGCCGCGCCAGC
AGGTTGACCTTTCTCGACGTCTCCAACAATCGGCTCGAGCAGCTGGAAAATGCCGAGCTCAACAGCCTCACGGGC
CTGCTCAAGATGAACCTGGCCAACAACCGGTTGACGCGGCTGCCGGCCTACTTTGACGCCTACCAGGCCCTACGG
AGCCTGAACATCTCGTCCAACTTCCTCGACGCCTTCCCGCCCTTTTTGTGCCAGCTGCGGAGCCTCGTGGACCTG
GACATGAGTTTCAACGCCATCGCCCGCCTGCCGGAAGAGATTGGCAACCTCAAGAATCTGGAAAAGTTTCTCATC
ACAAACAACAAGCTCACCGACGAGGTGCCGGCCGGCTTCCGAGGCCTGACGAGTCTGCGCGAGCTCGACATCAAG
TTCAATGCCATGACCAGTATCGACATCATCTCGGAGCTGCCCAAGCTGGAGATTCTGTGCGCGGCTCACAACAAC
GTTTCTTCGTTTTCGGGCAAGTTTGAGTGCATCCGGCAGCTGAAGCTCAACTCGAACCCGCTCAACAAGTTTGAG
TTCACGGAGCCGGTGCCGACGTTGACGACGCTGAACCTGTCGCACGCCCAGTTGGTGAGCATTGACTCGGCCTTT
GTTCACATGATGAACCTGGAGCGACTGGTGCTGGACCGCAACCACTTCGTGACGATACCGCAGCAGATTGGGATT
CTGAGCCGGCTGGAACACTTTAGCGTCGCCAACAACGCCGTGGCCGAGCTGCCGCCGCAGATTGGCTGCCTCGCG
GAGCTGCAAGTGCTGGACGTACGCGGCAACAACATATCGAAGCTGCCGCCCGAGATCTGGTGGGCCAACAAGCTG
GAGACGTTCAACGCGTCGTCCAACGTGCTCGACTCGTTCCCCAAGCCGTCTTCGAAGCCACCGCGAGCTCCCGGA
GGCGGGACCGGTGCCGGCAATGGCGGGGATGAGTCGGCGTCGGTTCCGGCGGGACCGCCTCCGACGCAGAACGGC
AAGCTGCAGGCGCCGACGGCACTGACGGCCGCGCCGAGTTCGGAGGAGTTGTCGGAGGAACGGCGGCCGAGTCAG
GGGTCGAGCACGCTGCTCAGCGTGGGCCCGTCACCGGTACAGGCGGCGGCCGACCGCAAGGGTTCTGTGGTTTCG
GTGTACGGCAAGGGCGGGCGCAAGACGTCGGTGGTATCGCGGGCGGCGTCGTCGCAGGCCGGGTCGACGAGCTCG
GGCGTAACGGCGCCGACGAACCCTAGGAAGGACTCGGGTGTCTCGTCGAAGCTGACGACGACGTTCGCCGGTTCG
TTACGCAACCTGTACCTGGCCGATAACCGGCTCGAGGACGACGTGTTTGACCAGATCACGCTGCTGTCGGAGCTG
CGGGTGCTCAACCTGTCGTACAACGAGGAGATTACCGACATGCCGCAGCGGTCCATCCGCAGCTGGCCGCAGCTG
GTGGAGCTGTATCTGTCCGGCAACGGGTTGACGAGCATCCCGGCCGACGACCTGGAGGAGACGAGTCTGCTGCAG
ACGCTGTGCATCAACGGCAACCGCTTCACCAACCTGCCGGCAGACATCTCGAGGGCCAAGAAGCTGGCCGTGTTT
GACTGCGGCAATAACTTCCTCAAGTACAACATCTGCAATGTTCCCTACGACTGGAACTGGAACCTCAACCCCAAC
CTGCGCTACCTCAACCTGTCTGGCAACAAACGACTGGAGATTAAGCAGACGGGCGGCGGCGGCGGCGGCGATGGC
CACGGAGCCGGCAACCGGGAGCAGTACACCGACTTCAACCGGCTGAGCAACCTGAGGGTGCTGGGCCTCATGGAC
GTGACGCTGACGCAGCCCAGCATCCCCGACCAGAGCGAAGATCGACGCGTGCGCACGTCGGGGTCGCTGGCGGGT
CATCTGCCGTACGGCATGGCGGACACGCTGGGCAAGAATGAGCACCTGTCGACGGTAGACCTGGTGGTCCCGCGC
TTCAACTCGTCCGAGACGGAGATGCTGCTGGGCCTGTTTGACGGCCAGGCTCTGTCAAGCGGCGGCTCCAAGATC
GCCAAGTATCTACACGAGAACTTTGGCCACATCTTTGCCATGGAGCTCAAGGGCCTCAAGACTCGACAGAACGAG
ACGCCGGTGGACGCGCTGAGACGGGCCTTTTTGGCGCTCAACAAGGACCTGGTGACGATTGCGGTACAGCCGCAG
CACGCCGAGGAGCGACCCAAGACGCGAGGGACTGCGCAGCCGGTGGTGCTGAGCCGCGAGGACCTCAACTCGGGC
GGCGTGGCGACGGTTGTTTACTTCCAGGGCACCGACCTGTACGTGGCCAACGTGGGCGACGCGCAGGCCATGGTG
ATTCAGATGGACGGCACTCACCAGATGCTCACTCGCAAGCATGATCCGGCCGAGGCTTCGGAACGGTCCCGGATC
CGCGACGCCGGCGGTTGGGTGTCGCGGAACGGACGGCTCAACGACCTGCTGCAGGTATCGCGGGCCTTTGGCTAC
GTCGACCTGATGCCGGCCGTTCAGGCGGCGCCGCACGTCAGCAGCATGAAGATGGGCGACAAGGAGGACATCATC
CTGCTGGCGACGAGCGAGCTGTGGGAGTATCTGGCTCCGGGCCTCATCACCGACATCGCCCGGGCCGAGCGACGC
GACCTGATGCGGGCGGCCCAGAAGCTTCGCGACCTGGCCGTGGCCTACGGCGCGTCGGGCAAGATCATGGTCATG
ATGATCAGCGTCGCCGACCTCAAGCGGCGCATGGAGCGCTCCCGCATGCACAGGGGCGCCAGCATGTCTCTCTAC
CCTTCGGGCGTCCCCGACGAGGCTCAGGCGCTGTCGACGACGCGCAGGGGTCGCAAGGCCAAGGGCGACGTGCTC
GACTCTTCGCTGGGCCGGCTCGAGGCTGAGATTCCGGCTCCCACGGGCAACGTGTCCATCGTCTTCACCGATATC
AAGAACTCGACCAACCTGTGGGAGATGTATCCGAGCGCCATGCGATCCGCCATCAAGCTGCACAACGAGGTCATG
AGACGTCAGCTGCGACGCATCGGAGGCTACGAGGTCAAGACGGAGGGCGACGCCTTCATGGTGTCGTTCCCCACG
GCCACGTCGGCCCTGCTGTGGTGTTTCGCCGTCCAGTTGTCGCTGCTCGACGTCAACTGGCCGTCGGAGATTCTC
AGCTCCATGTCGGGCCAGTCCGTCTTCGACAAGGACAACAACGTCATCTTCAAGGGCCTGTCGGTTCGCATGGGC
ATTCACTTTGGCGACTGCGTCAGCGAGACGGATCCCGTCACCCGTCGTATGGACTACTTCGGGCCCATGGTCAAC
AAGGCGGCCCGAGTCTCGGCCGTGGCCGACGGCGGTCAGATCACCGTCTCGACCGACTTCATCTCGGAGATCCAG
CGCTGTCTGGAGACGCACTCGGCCGACCGCGCCGGTTCGGTCACTACCGTTGATGATGACGTTGACGACGATCTG
TCTCACGCGGCTGCCATCCGCAAGGACCTGGCTGCCCTCACCTCGCAGGGCTTCGAGGTCAAGGAGATGGGCGAG
AAGAAGCTCAAGGGGCTCGAGAACCCGGAGATGATGTACTCGCTCTACCCTCACGGTCTGGCCGGCCGCGTCGAG
TATCACCTGAGGCACGAGCGCCGCGAGGCCGCCGCAGCCGCCGGAGTGGCCGTCGAGGAGCCGCGTCCGGCCGGC
CCGGGGCCCGAGTTGTCGTTCGACCCGGACACGCTGTGGGCGCTGTGGAGCGTCAGTCTCCGGCTCGAGATGCTG
TGCAGCAGCCTGGAGAAGGACAACGCCGATGGTGCGGCCTTGTGTCAGCCCGAGACGGGGGTGCTGGACCGCATG
AAGGCGAGGACCCACGACGTGACGGATCAGTTTCTGATCAACTTTGCCGAGCACCAAGTGAGCCGGATCGAGACA
TGCATCTCGACGCTCGCCATGCGCCATCTCGCCGTCGGAGGCGGCCCCTTGAAGGAGCTTGCCGACCTGCGAGCG
CCCATGGACTCGATCCTCGAGTTCTTCGTGCAGCAAAAGAAGGAGCTCGACCTTTACCGCAAGACGTTCGGCTCC
CTACACCGGACGGACGACGCCGCGGCCGCCGAGGTGGAGGAGCTGGACGGAGATGAAGAGGAAGTCGAGGGTGAG
ACCGACTGA
Gene >Ophun1|6019
ATGTCGGACAATGCGGCCGCCCGCTTCAGCTCCCTCACGAGCGCAAGCAACAGCACAGACGGCAGCTCGCGCACC
CTCAAGCCTGCGACTCCGCCTCCGCTGGCTCCCTCGTCGTCGACCTCATCATTGTCGGCTTCGCCATCCGCTCGG
CATATACACCGTGCCCATCGCGATCTCGACGCCAGTCCCGACCTTCGGCCCAAGTGAGTCCGGACCGGCCCCATG
TCTTGCTCCCTCCCCATCCGCCGCTGACGAAAGCCCCCTTCTCCCCTTTCTATAGGCCGCCGCCTCACGACGATG
CCTACGTCGCCGCCCCTCGCGGCTCGCAATCGTCCATGGCCAATGGCAGCGGTCGCCGTGACGGTGCCGCCCCCG
ACGCTTCTCGCGCCAACTCAATGGTCGCCCCTTGGGCTTCCAGCACGCCGCCGCCTCCTCCTCCAAAGGGTCCGC
TGAACGCGACTTCACACGACGACTCCAGCGATGGCACCTCGGCCGTATCGCAGTTCTCCACGGCCCTGGGCCTCT
CCGGCCTCCGCCACGGCGCCGTGCCCCCGGATATCCCCGAGTCCCCCGACACGTCCTACTTCCCCGTCGACGCTC
GCCGGCCGTCGCTCGCCAGCATCACAACGGCCAGTAGTCAGGGGTCCAGAACTAGCGGCACGCGCGGCGGCTACC
GCAAGCTCCAAGGCTTCTTTGGCGAAGAGTTTCCCGGGCGCGATAGCTCCGAAACTAGCCTGACCGCATCCGTCG
TCGGCAAGGACCAGCGCGCCCGATCTTACAGCCACACCCGCCCCTCCCAGCGAGACCGCAACTTCTCCAATGCCA
CTGATCCGAGAGACGCCTCGCCTTCCTCATCTCGCCCGAGGACCCCCGTGCCCTCATCTCAGGTCGTCCCCTTTC
TCTACCAGGACAACAACGTACGCTGCTCCCCCTTTCCCCTTCCCCCTCTCCCTTCTCGCTCTCCGTTATACTTTC
TCGCCAGAGTAGCGTCTCTCATACCTCTACTGCTGCTTCCCCTCCCCACACGCCAATCATGACGCCTCTCTCTTT
CTTGCCTGGCTCGCCGCTAGCACATCCCCGGCTGACTGCTTCCAGGACATCGCCCGTTACGGGGAGGCGCCCATC
AGGGATATTATGGCCGGTCCTGACCGAGAGCGATACGAAGCCTCGTCTCCCGCGCCCCTGATTCCCCCAAAGACC
TTGACCTCGTCCCGGTCTGCGAACCCTCTGGCTCACCTCCCCGGCCATCACCGGCACCACCGGAGCAACGAGGAC
CCGAGAGGCACCCCCCGGCCTTCCACCAGCCGGGACCCATCCCACGCCGCGGCCACGACGCCCAGCCTTCGCGAA
CGCGGTTCCTCGGTCAACATGCCCGGCCAGAGAGCGAGGGCCCAGAGCCCGGCGGCGCCCGGCGGCAACGGAGCC
TCCAAAGCCGGCGCCTCCGACCCGCCGACGTCGCCCGTCAAGAGAGGCTTCCTCGGTCGCCTCCGCCGTAACAAG
GACAAGGATAGGGACAGGGACAGGGATAGGGATAATAGGGATAGGGACTACCGAGCCCGAGATGAAGGCGTTTCC
GCCAATTCTCGCGATCTCCCCCAGCCCGCTCGCCCTCTCCAGGCCAAGGCTTCCAAGACGGACTTCTCCAGGCCG
GCCCTGTCTCCGCCTCAGGCTCAGGGGCACTGGCCCGGGGCCGTCGATGCCGCCTCCCGCGGACAGTCGTTCAAC
AAGTTCCCCTTCACCAGGAATAAGACGCGTCCCAGCCAGCGCAATGACTTGGGCGACGAGGCCATCGGCCCTACG
GACCCTCAGCAGCGCAGCGAGCCCCCCGACAGCAGCGTCTTCCACCTCGACACCGACCTCAACGACATGGAGGGC
ATCTTGCAGCCGCCTGCCACCGTCGTGCCTACTGACGCGCCCGCCCCCAACAACCCCGACGGCGAGCGGAAGGAC
TCGGCCATCGAGCAGCCCAAGGGCGGCTGGGATGCGCCCGACAGTTGGGCCGTCCGCCGCGACACCGAGGACGCG
TCCATCGTCTACGACTTGGATGAGACGGAGGAGTCGCCTCGGCCCGAGGAGAAACTGGCCCCCTACTTCATCCGC
ATCTTCCGCTCCGACGGCACCTTTTCCACTCACTCGATGCCCCTCGACTCCTCCTCGTCCGACGTCATCTCGCAG
GTGGTAAAGAAGACGTACGTCCTGGACGGGCTAGAGAACTACCACATCATTCTCAAGAAGCACGACCTCATCCGC
GTCCTCACGGCCGCCGACAGGCCCCTGCTCTTGCAGAAGCGTCTGCTGCAACAAGTTGGCTACGAGGAAAAGGAC
AGGATCGAGGATCTCGGCCGCGAGGACAATGGCTACCTCTGCCGATTCATGTTTCTGTCGGCGCGAGAGAGCGAC
TTTCACGCAAAGACTAATGATCTGGGCTTTTCGCGCTCTCAGAAGATTAACCACGTCGACCTTTCGGGCCGCAAC
CTCGTCACCATTCCCATCTCGCTCTACTCCAAGGCGGCTGACATCACCTCGCTTAACCTGTCGAGGAATCTGTCG
CTGGACGTACCTCGAGATTTCATCCAGTCTTGCAAGCACCTGCGTGACATCAAGTTCACCAACAACGAAGTTCGC
AAGCTGCCCGTCAGCCTCAGCCGCGCCAGCAGGTTGACCTTTCTCGACGTCTCCAACAATCGGCTCGAGCAGCTG
GAAAATGCCGAGCTCAACAGCCTCACGGGCCTGCTCAAGATGAACCTGGCCAACAACCGGTTGACGCGGCTGCCG
GCCTACTTTGACGCCTACCAGGCCCTACGGAGCCTGAACATCTCGTCCAACTTCCTCGACGCCTTCCCGCCCTTT
TTGTGCCAGCTGCGGAGCCTCGTGGACCTGGACATGAGTTTCAACGCCATCGCCCGCCTGCCGGAAGAGATTGGC
AACCTCAAGAATCTGGAAAAGTTTCTCATCACAAACAACAAGCTCACCGACGAGGTGCCGGCCGGCTTCCGAGGC
CTGACGAGTCTGCGCGAGCTCGACATCAAGTTCAATGCCATGACCAGTATCGACATCATCTCGGAGCTGCCCAAG
CTGGAGATTCTGTGCGCGGCTCACAACAACGTTTCTTCGTTTTCGGGCAAGTTTGAGTGCATCCGGCAGCTGAAG
CTCAACTCGAACCCGCTCAACAAGTTTGAGTTCACGGAGCCGGTGCCGACGTTGACGACGCTGAACCTGTCGCAC
GCCCAGTTGGTGAGCATTGACTCGGCCTTTGTTCACATGATGAACCTGGAGCGACTGGTGCTGGACCGCAACCAC
TTCGTGACGATACCGCAGCAGATTGGGATTCTGAGCCGGCTGGAACACTTTAGCGTCGCCAACAACGCCGTGGCC
GAGCTGCCGCCGCAGATTGGCTGCCTCGCGGAGCTGCAAGTGCTGGACGTACGCGGCAACAACATATCGAAGCTG
CCGCCCGAGATCTGGTGGGCCAACAAGCTGGAGACGTTCAACGCGTCGTCCAACGTGCTCGACTCGTTCCCCAAG
CCGTCTTCGAAGCCACCGCGAGCTCCCGGAGGCGGGACCGGTGCCGGCAATGGCGGGGATGAGTCGGCGTCGGTT
CCGGCGGGACCGCCTCCGACGCAGAACGGCAAGCTGCAGGCGCCGACGGCACTGACGGCCGCGCCGAGTTCGGAG
GAGTTGTCGGAGGAACGGCGGCCGAGTCAGGGGTCGAGCACGCTGCTCAGCGTGGGCCCGTCACCGGTACAGGCG
GCGGCCGACCGCAAGGGTTCTGTGGTTTCGGTGTACGGCAAGGGCGGGCGCAAGACGTCGGTGGTATCGCGGGCG
GCGTCGTCGCAGGCCGGGTCGACGAGCTCGGGCGTAACGGCGCCGACGAACCCTAGGAAGGACTCGGGTGTCTCG
TCGAAGCTGACGACGACGTTCGCCGGTTCGTTACGCAACCTGTACCTGGCCGATAACCGGCTCGAGGACGACGTG
TTTGACCAGATCACGCTGCTGTCGGAGCTGCGGGTGCTCAACCTGTCGTACAACGAGGAGATTACCGACATGCCG
CAGCGGTCCATCCGCAGCTGGCCGCAGCTGGTGGAGCTGTATCTGTCCGGCAACGGGTTGACGAGCATCCCGGCC
GACGACCTGGAGGAGACGAGTCTGCTGCAGACGCTGTGCATCAACGGCAACCGCTTCACCAACCTGCCGGCAGAC
ATCTCGAGGGCCAAGAAGCTGGCCGTGTTTGACTGCGGCAATAACTTCCTCAAGTACAACATCTGCAATGTTCCC
TACGACTGGAACTGGAACCTCAACCCCAACCTGCGCTACCTCAACCTGTCTGGCAACAAACGACTGGAGATTAAG
CAGACGGGCGGCGGCGGCGGCGGCGATGGCCACGGAGCCGGCAACCGGGAGCAGTACACCGACTTCAACCGGCTG
AGCAACCTGAGGGTGCTGGGCCTCATGGACGTGACGCTGACGCAGCCCAGCATCCCCGACCAGAGCGAAGATCGA
CGCGTGCGCACGTCGGGGTCGCTGGCGGGTCATCTGCCGTACGGCATGGCGGACACGCTGGGCAAGAATGAGCAC
CTGTCGACGGTAGACCTGGTGGTCCCGCGCTTCAACTCGTCCGAGACGGAGATGCTGCTGGGCCTGTTTGACGGC
CAGGCTCTGTCAAGCGGCGGCTCCAAGATCGCCAAGTATCTACACGAGAACTTTGGCCACATCTTTGCCATGGAG
CTCAAGGGCCTCAAGACTCGACAGAACGAGACGCCGGTGGACGCGCTGAGACGGGCCTTTTTGGCGCTCAACAAG
GACCTGGTGACGATTGCGGTACAGCCGCAGCACGCCGAGGAGCGACCCAAGACGCGAGGGACTGCGCAGCCGGTG
GTGCTGAGCCGCGAGGACCTCAACTCGGGCGGCGTGGCGACGGTTGTTTACTTCCAGGGCACCGACCTGTACGTG
GCCAACGTGGGCGACGCGCAGGCCATGGTGATTCAGATGGACGGCACTCACCAGATGCTCACTCGCAAGCATGAT
CCGGCCGAGGCTTCGGAACGGTCCCGGATCCGCGACGCCGGCGGTTGGGTGTCGCGGAACGGACGGCTCAACGAC
CTGCTGCAGGTATCGCGGGCCTTTGGCTACGTCGACCTGATGCCGGCCGTTCAGGCGGCGCCGCACGTCAGCAGC
ATGAAGATGGGCGACAAGGAGGACATCATCCTGCTGGCGACGAGCGAGCTGTGGGAGTATCTGGCTCCGGGCCTC
ATCACCGACATCGCCCGGGCCGAGCGACGCGACCTGATGCGGGCGGCCCAGAAGCTTCGCGACCTGGCCGTGGCC
TACGGCGCGTCGGGCAAGATCATGGTCATGATGATCAGCGTCGCCGACCTCAAGCGGCGCATGGAGCGCTCCCGC
ATGCACAGGGGCGCCAGCATGTCTCTCTACCCTTCGGGCGTCCCCGACGAGGCTCAGGCGCTGTCGACGACGCGC
AGGGGTCGCAAGGCCAAGGGCGACGTGCTCGACTCTTCGCTGGGCCGGCTCGAGGCTGAGATTCCGGCTCCCACG
GGCAACGTGTCCATCGTCTTCACCGATATCAAGAACTCGACCAACCTGTGGGAGATGTATCCGAGCGCCATGCGA
TCCGCCATCAAGCTGCACAACGAGGTCATGAGACGTCAGCTGCGACGCATCGGAGGCTACGAGGTCAAGACGGAG
GGCGACGCCTTCATGGTGTCGTTCCCCACGGCCACGTCGGCCCTGCTGTGGTGTTTCGCCGTCCAGTTGTCGCTG
CTCGACGTCAACTGGCCGTCGGAGATTCTCAGCTCCATGTCGGGCCAGTCCGTCTTCGACAAGGACAACAACGTC
ATCTTCAAGGGCCTGTCGGTTCGCATGGGCATTCACTTTGGCGACTGCGTCAGCGAGACGGATCCCGTCACCCGT
CGTATGGACTACTTCGGGCCCATGGTCAACAAGGCGGCCCGAGTCTCGGCCGTGGCCGACGGCGGTCAGATCACC
GTCTCGACCGACTTCATCTCGGAGATCCAGCGCTGTCTGGAGACGCACTCGGCCGACCGCGCCGGTTCGGTCACT
ACCGTTGATGATGACGTTGACGACGATCTGTCTCACGCGGCTGCCATCCGCAAGGACCTGGCTGCCCTCACCTCG
CAGGGCTTCGAGGTCAAGGAGATGGGCGAGAAGAAGCTCAAGGGGCTCGAGAACCCGGAGATGATGTACTCGCTC
TACCCTCACGGTCTGGCCGGCCGCGTCGAGTATCACCTGAGGCACGAGCGCCGCGAGGCCGCCGCAGCCGCCGGA
GTGGCCGTCGAGGAGCCGCGTCCGGCCGGCCCGGGGCCCGAGTTGTCGTTCGACCCGGACACGCTGTGGGCGCTG
TGGAGCGTCAGTCTCCGGCTCGAGATGCTGTGCAGCAGCCTGGAGAAGGACAACGCCGATGGTGCGGCCTTGTGT
CAGCCCGAGACGGGGGTGCTGGACCGCATGAAGGCGAGGACCCACGACGTGACGGATCAGTTTCTGATCAACTTT
GCCGAGCACCAAGTGAGCCGGATCGAGGTGCGTTTTCCGTCCAATTCCTCTTGTTCTTGAATTTCCTGTGCTGAC
TCTCCCTCACAGACATGCATCTCGACGCTCGCCATGCGCCATCTCGCCGTCGGAGGCGGCCCCTTGAAGGAGCTT
GCCGACCTGCGAGCGCCCATGGACTCGATCCTCGAGTTCTTCGTGCAGCAAAAGAAGGAGCTCGACCTTTACCGC
AAGACGTTCGGCTCCCTACACCGGACGGACGACGCCGCGGCCGCCGAGGTGGAGGAGCTGGACGGAGATGAAGAG
GAAGTCGAGGGTGAGACCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail