Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6015
Gene name
LocationContig_627:4632..5214
Strand-
Gene length (bp)582
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09447 Cnl2_NKP2 Cnl2/NKP2 family protein 3.4E-22 6 68

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000776 kinetochore Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0099080 supramolecular complex No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1201
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|25
Ophiocordyceps australis map64 (Brazil) OphauB2|1565
Ophiocordyceps camponoti-floridani Ophcf2|05769
Ophiocordyceps camponoti-rufipedis Ophun1|6015 (this protein)
Ophiocordyceps kimflemingae Ophio5|5978
Ophiocordyceps subramaniannii Hirsu2|1035

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6015
MTPPTEQEILTNYLIQPGPLINITTLPQFQSLFPTHLRNSPMIRTLFRDLQEQRGLTVDAVRRSITAETLQGERL
VKQMLRQERDALVLDPDIELDIEQELGDDTAAKEPVARQLEFLVHLINNSIKMLTAKVEMMVEEELELVERAKEA
AGGLSDLRYGRFENGELGGQVTEGVQIFCDTCHYKRLGRRSSQ*
Coding >Ophun1|6015
ATGACGCCTCCCACGGAACAAGAGATCCTCACCAACTACCTCATCCAACCAGGCCCCCTCATAAACATCACAACC
TTGCCGCAATTCCAGTCCCTCTTCCCCACTCACCTGCGCAACTCGCCCATGATCCGCACCCTCTTCCGCGACCTC
CAGGAGCAGCGCGGCCTGACAGTCGACGCGGTGCGTCGCAGCATCACGGCCGAGACGCTGCAAGGCGAACGCCTC
GTCAAGCAAATGCTGCGTCAGGAGCGCGACGCCCTGGTCCTCGACCCGGATATCGAGCTTGATATCGAGCAGGAG
CTCGGTGACGACACCGCTGCGAAAGAGCCGGTGGCGCGCCAGCTGGAGTTCCTGGTGCACCTTATCAACAATTCC
ATCAAGATGCTGACGGCCAAGGTGGAGATGATGGTCGAGGAGGAGCTGGAGCTGGTGGAGCGCGCAAAGGAGGCG
GCTGGCGGGTTGAGCGATTTGCGCTACGGCAGGTTTGAGAATGGGGAGTTGGGCGGGCAGGTCACTGAAGGCGTG
CAGATTTTCTGCGACACGTGTCATTACAAGCGGCTGGGGAGGAGAAGCTCGCAATGA
Transcript >Ophun1|6015
ATGACGCCTCCCACGGAACAAGAGATCCTCACCAACTACCTCATCCAACCAGGCCCCCTCATAAACATCACAACC
TTGCCGCAATTCCAGTCCCTCTTCCCCACTCACCTGCGCAACTCGCCCATGATCCGCACCCTCTTCCGCGACCTC
CAGGAGCAGCGCGGCCTGACAGTCGACGCGGTGCGTCGCAGCATCACGGCCGAGACGCTGCAAGGCGAACGCCTC
GTCAAGCAAATGCTGCGTCAGGAGCGCGACGCCCTGGTCCTCGACCCGGATATCGAGCTTGATATCGAGCAGGAG
CTCGGTGACGACACCGCTGCGAAAGAGCCGGTGGCGCGCCAGCTGGAGTTCCTGGTGCACCTTATCAACAATTCC
ATCAAGATGCTGACGGCCAAGGTGGAGATGATGGTCGAGGAGGAGCTGGAGCTGGTGGAGCGCGCAAAGGAGGCG
GCTGGCGGGTTGAGCGATTTGCGCTACGGCAGGTTTGAGAATGGGGAGTTGGGCGGGCAGGTCACTGAAGGCGTG
CAGATTTTCTGCGACACGTGTCATTACAAGCGGCTGGGGAGGAGAAGCTCGCAATGA
Gene >Ophun1|6015
ATGACGCCTCCCACGGAACAAGAGATCCTCACCAACTACCTCATCCAACCAGGCCCCCTCATAAACATCACAACC
TTGCCGCAATTCCAGTCCCTCTTCCCCACTCACCTGCGCAACTCGCCCATGATCCGCACCCTCTTCCGCGACCTC
CAGGAGCAGCGCGGCCTGACAGTCGACGCGGTGCGTCGCAGCATCACGGCCGAGACGCTGCAAGGCGAACGCCTC
GTCAAGCAAATGCTGCGTCAGGAGCGCGACGCCCTGGTCCTCGACCCGGATATCGAGCTTGATATCGAGCAGGAG
CTCGGTGACGACACCGCTGCGAAAGAGCCGGTGGCGCGCCAGCTGGAGTTCCTGGTGCACCTTATCAACAATTCC
ATCAAGATGCTGACGGCCAAGGTGGAGATGATGGTCGAGGAGGAGCTGGAGCTGGTGGAGCGCGCAAAGGAGGCG
GCTGGCGGGTTGAGCGATTTGCGCTACGGCAGGTTTGAGAATGGGGAGTTGGGCGGGCAGGTCACTGAAGGCGTG
CAGATTTTCTGCGACACGTGTCATTACAAGCGGCTGGGGAGGAGAAGCTCGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail