Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6008
Gene name
LocationContig_626:1208..2118
Strand-
Gene length (bp)910
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04176 TIP41 TIP41-like family 4.3E-67 61 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5FW12|TIPRL_XENTR TIP41-like protein OS=Xenopus tropicalis GN=tiprl PE=2 SV=1 32 239 2.0E-46
sp|Q54MI6|TIPRL_DICDI TIP41-like protein OS=Dictyostelium discoideum GN=tiprl PE=3 SV=1 34 240 3.0E-43
sp|Q9USK5|TIP41_SCHPO Type 2A phosphatase activator tip41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tip41 PE=2 SV=1 31 279 1.0E-40
sp|O75663|TIPRL_HUMAN TIP41-like protein OS=Homo sapiens GN=TIPRL PE=1 SV=2 32 239 2.0E-40
sp|Q6IRA8|TIPRL_XENLA TIP41-like protein OS=Xenopus laevis GN=tiprl PE=2 SV=1 32 239 4.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5FW12|TIPRL_XENTR TIP41-like protein OS=Xenopus tropicalis GN=tiprl PE=2 SV=1 32 239 2.0E-46
sp|Q54MI6|TIPRL_DICDI TIP41-like protein OS=Dictyostelium discoideum GN=tiprl PE=3 SV=1 34 240 3.0E-43
sp|Q9USK5|TIP41_SCHPO Type 2A phosphatase activator tip41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tip41 PE=2 SV=1 31 279 1.0E-40
sp|O75663|TIPRL_HUMAN TIP41-like protein OS=Homo sapiens GN=TIPRL PE=1 SV=2 32 239 2.0E-40
sp|Q6IRA8|TIPRL_XENLA TIP41-like protein OS=Xenopus laevis GN=tiprl PE=2 SV=1 32 239 4.0E-40
sp|Q8BH58|TIPRL_MOUSE TIP41-like protein OS=Mus musculus GN=Tiprl PE=1 SV=1 32 234 5.0E-40
sp|A2VCX1|TIPRL_RAT TIP41-like protein OS=Rattus norvegicus GN=Tiprl PE=1 SV=1 32 234 6.0E-40
sp|Q12199|TIP41_YEAST Type 2A phosphatase activator TIP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIP41 PE=1 SV=1 32 279 3.0E-37
sp|P34274|TIPRL_CAEEL TIP41-like protein OS=Caenorhabditis elegans GN=C02C2.6 PE=3 SV=3 59 236 1.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0043666 regulation of phosphoprotein phosphatase activity Yes
GO:0035303 regulation of dephosphorylation No
GO:0035304 regulation of protein dephosphorylation No
GO:0019220 regulation of phosphate metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0051174 regulation of phosphorus metabolic process No
GO:0051336 regulation of hydrolase activity No
GO:0010921 regulation of phosphatase activity No
GO:0065009 regulation of molecular function No
GO:0050789 regulation of biological process No
GO:0050790 regulation of catalytic activity No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0031399 regulation of protein modification process No
GO:0065007 biological regulation No
GO:0051246 regulation of protein metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2070
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5953
Ophiocordyceps australis map64 (Brazil) OphauB2|7938
Ophiocordyceps camponoti-floridani Ophcf2|06486
Ophiocordyceps camponoti-rufipedis Ophun1|6008 (this protein)
Ophiocordyceps kimflemingae Ophio5|2977
Ophiocordyceps subramaniannii Hirsu2|2392

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6008
MSEINHISDPNEPFLSRTDVDAATTAHKQAHFRISTRKLPISKAGAIDAMTERIGIPLPEMIFGDNVVELRHLPS
GWTISFNTPDALDAVDKTAEHVLKVAYARDWESSREGTTSKIRDAVKPYDWSYSTTYRGTVDVGSGSAFQPTDKQ
IPIELLKRRDPMLFFDEVLLFESELDDNGISVCSVKLRVHRKRMLLLCRLFMRLDNVVVRLRDTRIYVDFETDEV
IRDYTAKEASFESVKRTLLSTGLLTDDVTVALRDPNQLDPLLSTMEHQTEAVNLSAL*
Coding >Ophun1|6008
ATGTCGGAAATCAACCACATCTCGGACCCCAACGAGCCGTTTCTGAGCCGGACCGATGTCGATGCCGCGACGACG
GCACACAAGCAAGCCCACTTCCGGATATCGACGCGCAAGCTGCCCATCTCCAAGGCGGGGGCTATCGACGCCATG
ACGGAGCGCATCGGCATTCCGCTGCCGGAGATGATATTTGGCGATAATGTGGTGGAGCTGCGGCATCTGCCCTCG
GGATGGACCATCAGCTTCAACACGCCCGACGCCCTCGACGCCGTTGATAAGACAGCCGAGCATGTCCTCAAGGTC
GCCTACGCCCGCGACTGGGAGAGCTCGCGCGAGGGAACGACGAGCAAGATCAGGGACGCCGTCAAGCCGTACGAC
TGGAGCTACTCAACGACGTACCGCGGCACTGTCGACGTCGGAAGCGGGTCTGCCTTCCAACCTACGGATAAGCAG
ATCCCCATTGAGCTTCTCAAGCGTCGCGACCCTATGCTCTTCTTTGACGAGGTACTGCTTTTTGAGAGCGAGCTC
GACGACAACGGCATTTCGGTTTGCAGCGTCAAGCTCCGTGTTCACAGGAAACGGATGTTGCTCCTTTGCCGGCTG
TTTATGCGGCTTGATAACGTTGTTGTTCGCTTGCGGGATACGCGTATATACGTCGACTTTGAGACCGATGAGGTG
ATTAGGGACTACACTGCCAAGGAGGCGAGCTTTGAGAGTGTCAAGAGGACACTCCTCTCGACCGGGCTGCTAACC
GACGACGTGACGGTGGCCCTAAGAGATCCCAACCAGCTGGACCCCTTGCTGTCCACGATGGAGCACCAGACCGAG
GCCGTCAATTTGAGCGCGCTGTAG
Transcript >Ophun1|6008
ATGTCGGAAATCAACCACATCTCGGACCCCAACGAGCCGTTTCTGAGCCGGACCGATGTCGATGCCGCGACGACG
GCACACAAGCAAGCCCACTTCCGGATATCGACGCGCAAGCTGCCCATCTCCAAGGCGGGGGCTATCGACGCCATG
ACGGAGCGCATCGGCATTCCGCTGCCGGAGATGATATTTGGCGATAATGTGGTGGAGCTGCGGCATCTGCCCTCG
GGATGGACCATCAGCTTCAACACGCCCGACGCCCTCGACGCCGTTGATAAGACAGCCGAGCATGTCCTCAAGGTC
GCCTACGCCCGCGACTGGGAGAGCTCGCGCGAGGGAACGACGAGCAAGATCAGGGACGCCGTCAAGCCGTACGAC
TGGAGCTACTCAACGACGTACCGCGGCACTGTCGACGTCGGAAGCGGGTCTGCCTTCCAACCTACGGATAAGCAG
ATCCCCATTGAGCTTCTCAAGCGTCGCGACCCTATGCTCTTCTTTGACGAGGTACTGCTTTTTGAGAGCGAGCTC
GACGACAACGGCATTTCGGTTTGCAGCGTCAAGCTCCGTGTTCACAGGAAACGGATGTTGCTCCTTTGCCGGCTG
TTTATGCGGCTTGATAACGTTGTTGTTCGCTTGCGGGATACGCGTATATACGTCGACTTTGAGACCGATGAGGTG
ATTAGGGACTACACTGCCAAGGAGGCGAGCTTTGAGAGTGTCAAGAGGACACTCCTCTCGACCGGGCTGCTAACC
GACGACGTGACGGTGGCCCTAAGAGATCCCAACCAGCTGGACCCCTTGCTGTCCACGATGGAGCACCAGACCGAG
GCCGTCAATTTGAGCGCGCTGTAG
Gene >Ophun1|6008
ATGTCGGAAATCAACCACATCTCGGACCCCAACGAGCCGTTTCTGAGCCGGACCGATGTCGATGCCGCGACGACG
GCACACAAGCAAGCCCACTTCCGGATATCGACGCGCAAGCTGCCCATCTCCAAGGCGGGGGCTATCGACGCCATG
ACGGAGCGCATCGGCATTCCGCTGCCGGAGATGATATTTGGCGATAATGTGGTGGAGCTGCGGCATCTGCCCTCG
GGATGGACCATCAGCTTCAACACGCCCGACGCCCTCGACGCCGTTGATAAGACAGCCGAGCATGTCCTCAAGGTC
GCCTACGCCCGCGACTGGGAGAGCTCGCGCGAGGGAACGACGAGCAAGATCAGGGACGCCGTCAAGCCGTACGAC
TGGAGCTACTCAACGACGTACCGCGGCACTGTCGACGTCGGAAGCGGGTCTGCCTTCCAACCTACGGATAAGCAG
ATCCCCATTGAGCTTCTCAAGCGTCGCGACCCTATGCTCTTCTTTGACGAGGTACTGCTTTTTGAGAGCGAGCTC
GACGACAACGGCATTTCGGTTTGCAGCGTCAAGCTCCGTGTTCACAGGAAACGGATGTTGCTCCTTTGCCGGCTG
TTTATGCGGCTTGATAACGTTGTTGTTCGCTTGCGGGATACGCGTATATACGTCGACTTTGAGACCGATGAGGTG
ATTAGGGACTACACTGCCAAGGAGGCGAGCTTTGAGAGTGTCAAGAGGGTAGGGTTCTTTCGGGAGAATTTCTCA
GTCGGGAAGTTGCTGATGGAGACTCGCTACTCAGACACTCCTCTCGACCGGGCTGCTAACCGACGACGTGACGGT
GGCCCTAAGAGATCCCAACCAGCTGGACCCCTTGCTGTCCACGATGGAGCACCAGACCGAGGCCGTCAATTTGAG
CGCGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail