Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6007
Gene name
LocationContig_625:9290..10220
Strand-
Gene length (bp)930
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 7.8E-55 6 243
PF13460 NAD_binding_10 NAD(P)H-binding 8.0E-18 9 158
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 2.6E-05 7 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 3 265 3.0E-47
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 3 265 4.0E-43
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 3 265 6.0E-40
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 3 265 1.0E-39
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 1 256 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 3 265 3.0E-47
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 3 265 4.0E-43
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 3 265 6.0E-40
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 3 265 1.0E-39
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 1 256 1.0E-22
sp|P23762|NMR1_NEUCR Nitrogen metabolite repression protein nmr OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmr PE=1 SV=2 3 287 2.0E-17
sp|Q5AU62|NMRA_EMENI Nitrogen metabolite repression protein nmrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nmrA PE=1 SV=1 3 267 1.0E-11
sp|Q8KU07|AZOB_XENAZ NAD(P)H azoreductase OS=Xenophilus azovorans GN=azoB PE=1 SV=2 4 176 7.0E-09
sp|P39315|QOR2_ECOLI Quinone oxidoreductase 2 OS=Escherichia coli (strain K12) GN=qorB PE=1 SV=1 4 163 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016229 steroid dehydrogenase activity No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008202 steroid metabolic process No
GO:0008150 biological_process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016491 oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup298
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4304
Ophiocordyceps australis 1348a (Ghana) OphauG2|7451
Ophiocordyceps australis map64 (Brazil) OphauB2|6316
Ophiocordyceps camponoti-floridani Ophcf2|00005
Ophiocordyceps camponoti-rufipedis Ophun1|6007 (this protein)
Ophiocordyceps kimflemingae Ophio5|3695
Ophiocordyceps kimflemingae Ophio5|4441
Ophiocordyceps subramaniannii Hirsu2|10094
Ophiocordyceps subramaniannii Hirsu2|6272
Ophiocordyceps subramaniannii Hirsu2|9565

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6007
MVKILTVFGATGNQGGSVIKAVLADDKLRSEFRIRAVTRDSSKPAATELSARGVDVIQADMSSSAAAAPAVQGAH
TVFFVTNFWESMSAETEKAQGRAVTDACKAAGVEHIIFSSLPNVSKMSEGKLTGVTHFDSKAWIEQYIRDSGIPA
TFVLAGLFMSNFFGFIRKADDEGNSYALAWPEGVGIDSAPIPVLDAAGDTGKFVKPALSRFPDLVGRRILAATSY
MTVSELLATFSDVMGKPAQARVLPAETWKSFLPPEGAQELLENMLLLEKPGYFGGEKLEESLALLDEKPTSWRAF
VEGNREKWL*
Coding >Ophun1|6007
ATGGTCAAGATCCTCACCGTCTTCGGCGCCACGGGCAACCAGGGCGGCTCCGTCATCAAGGCGGTGCTGGCCGAC
GACAAGCTCCGGAGCGAGTTCCGGATCCGGGCCGTGACGCGTGACAGCAGCAAGCCGGCGGCCACGGAGCTCTCG
GCCCGGGGCGTCGACGTGATACAGGCCGACATGAGCAGCTCCGCGGCTGCGGCTCCGGCCGTCCAGGGCGCCCAT
ACCGTCTTCTTTGTCACCAACTTCTGGGAGAGCATGTCGGCCGAGACGGAGAAGGCCCAGGGCCGGGCGGTGACG
GATGCTTGCAAGGCGGCCGGCGTCGAGCACATCATCTTCTCGTCGCTTCCAAACGTCAGCAAGATGAGCGAGGGG
AAGCTGACGGGGGTGACGCATTTTGATAGCAAGGCTTGGATCGAGCAGTACATCCGCGATTCGGGCATCCCGGCC
ACGTTTGTCCTCGCCGGTCTCTTCATGTCCAACTTCTTCGGTTTCATCCGCAAGGCCGACGACGAGGGCAACAGC
TACGCTCTGGCATGGCCCGAGGGCGTCGGAATCGACTCGGCGCCCATCCCGGTGCTGGACGCGGCGGGTGACACG
GGCAAGTTCGTCAAGCCTGCGCTGAGCCGGTTCCCGGACCTGGTCGGGCGGCGGATCCTTGCGGCCACGAGCTAC
ATGACCGTCTCTGAGCTGCTGGCGACCTTTTCCGACGTCATGGGGAAGCCGGCGCAGGCGCGGGTGTTGCCGGCC
GAGACGTGGAAGTCTTTTCTGCCGCCTGAGGGGGCGCAGGAGCTGTTGGAGAATATGCTGCTGTTGGAGAAGCCG
GGGTATTTTGGGGGGGAGAAGCTTGAGGAGAGCTTGGCTTTATTGGATGAGAAGCCGACGAGTTGGAGGGCTTTT
GTGGAGGGGAATAGGGAGAAGTGGTTGTGA
Transcript >Ophun1|6007
ATGGTCAAGATCCTCACCGTCTTCGGCGCCACGGGCAACCAGGGCGGCTCCGTCATCAAGGCGGTGCTGGCCGAC
GACAAGCTCCGGAGCGAGTTCCGGATCCGGGCCGTGACGCGTGACAGCAGCAAGCCGGCGGCCACGGAGCTCTCG
GCCCGGGGCGTCGACGTGATACAGGCCGACATGAGCAGCTCCGCGGCTGCGGCTCCGGCCGTCCAGGGCGCCCAT
ACCGTCTTCTTTGTCACCAACTTCTGGGAGAGCATGTCGGCCGAGACGGAGAAGGCCCAGGGCCGGGCGGTGACG
GATGCTTGCAAGGCGGCCGGCGTCGAGCACATCATCTTCTCGTCGCTTCCAAACGTCAGCAAGATGAGCGAGGGG
AAGCTGACGGGGGTGACGCATTTTGATAGCAAGGCTTGGATCGAGCAGTACATCCGCGATTCGGGCATCCCGGCC
ACGTTTGTCCTCGCCGGTCTCTTCATGTCCAACTTCTTCGGTTTCATCCGCAAGGCCGACGACGAGGGCAACAGC
TACGCTCTGGCATGGCCCGAGGGCGTCGGAATCGACTCGGCGCCCATCCCGGTGCTGGACGCGGCGGGTGACACG
GGCAAGTTCGTCAAGCCTGCGCTGAGCCGGTTCCCGGACCTGGTCGGGCGGCGGATCCTTGCGGCCACGAGCTAC
ATGACCGTCTCTGAGCTGCTGGCGACCTTTTCCGACGTCATGGGGAAGCCGGCGCAGGCGCGGGTGTTGCCGGCC
GAGACGTGGAAGTCTTTTCTGCCGCCTGAGGGGGCGCAGGAGCTGTTGGAGAATATGCTGCTGTTGGAGAAGCCG
GGGTATTTTGGGGGGGAGAAGCTTGAGGAGAGCTTGGCTTTATTGGATGAGAAGCCGACGAGTTGGAGGGCTTTT
GTGGAGGGGAATAGGGAGAAGTGGTTGTGA
Gene >Ophun1|6007
ATGGTCAAGATCCTCACCGTCTTCGGCGCCACGGGCAACCAGGGCGGCTCCGTCATCAAGGCGGTGCTGGCCGAC
GACAAGCTCCGGAGCGAGTTCCGGATCCGGGCCGTGACGCGTGACAGCAGCAAGCCGGCGGCCACGGAGCTCTCG
GCCCGGGGCGTCGACGTGATACAGGCCGACATGAGCAGCTCCGCGGCTGCGGCTCCGGCCGTCCAGGGCGCCCAT
ACCGTCTTCTTTGTCACCAACTTCTGGGAGAGCATGTCGGCCGAGACGGAGAAGGCCCAGGGCCGGGCGGTGACG
GATGCTTGCAAGGCGGCCGGCGTCGAGCACATCATCTTCTCGTCGCTTCCAAACGTCAGCAAGATGAGCGAGGGG
AAGCTGACGGGGGTGACGCATTTTGATAGCAAGGCTTGGATCGAGCAGTACATCCGCGATTCGGGCATCCCGGCC
ACGTTTGTCCTCGCCGGTCTCTTCATGTCCAACTTCTTCGGTTTCATCCGCAAGGCCGACGACGAGGGCAACAGC
TACGCTCTGGCATGGCCCGAGGGCGTCGGAATCGACTCGGCGCCCATCCCGGTGCTGGACGCGGCGGGTGACACG
GGCAAGTTCGTCAAGCCTGCGCTGAGCCGGTTCCCGGACCTGGTCGGGCGGCGGATCCTTGCGGCCACGAGCTAC
ATGACCGTCTCTGAGCTGCTGGCGACCTTTTCCGACGTCATGGGGAAGCCGGCGCAGGCGCGGGTGTTGCCGGCC
GAGACGTGGAAGTCTTTTCTGCCGCCTGAGGGGGCGCAGGAGCTGTTGGAGAATATGCTGCTGTTGGAGAAGCCG
GGGTATTTTGGGGGGGAGAAGCTTGAGGAGAGCTTGGCTTTATTGGATGAGAAGCCGACGAGTTGGAGGGCTTTT
GTGGAGGGGAATAGGGAGAAGTGGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail