Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6003
Gene name
LocationContig_624:7965..9892
Strand+
Gene length (bp)1927
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 6.1E-11 342 391
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.1E-08 342 391
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 9.8E-07 358 390
PF13445 zf-RING_UBOX RING-type zinc-finger 1.7E-05 343 388
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 3.1E-05 338 393
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.9E-05 343 390

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 343 397 2.0E-07
sp|P38239|YBR2_YEAST Uncharacterized RING finger protein YBR062C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR062C PE=1 SV=2 331 428 9.0E-06

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0097602 cullin family protein binding Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0046872 metal ion binding Yes
GO:0140513 nuclear protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0016740 transferase activity No
GO:0004842 ubiquitin-protein transferase activity No
GO:0009056 catabolic process No
GO:0006508 proteolysis No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0009987 cellular process No
GO:1902494 catalytic complex No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1990234 transferase complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005515 protein binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043167 ion binding No
GO:0030163 protein catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0019538 protein metabolic process No
GO:0010498 proteasomal protein catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6003
MDPINYLPPGTGPRLPHHGDGHTASWAPSHQTHPRLPPTAPWPASSAVSTSPLYFGPSAQQQQLEQQQQQQQQQQ
QQQQHPRPPQLGRSLSPSPSFGLGLQGSLPHPDAGLRGVQPQNSDGLFTPARLHSFASIGQAGLVLHPAGFGPPP
GLGPQPPTLGPGRGEAGRGELPIFPLAEPLPNPYGPRNLSGHPYSLAYPRRSGSVASVSAGPRFLQPAAAVSGNA
PVPSTTSTRNTSALPSPITDRRRQGLSRARRYLTSRHSAPDAVQDTAVMAEVADGRLSRHPGHNLTEHLNYVIPD
DAALRQLQLARGAIPSKLIASTVALQSLQVVDVKSLSANERMCVICYNDYGVQSIEGVVEAPLRLPNCKHVFGNQ
CIKKWLEDSDSCPYCRDKLPSEPKVGQTTAAGHAFMTLLRRRDSQASSPEGYYRRMLSRFRSGELVELGLRHGRA
AERRSPPADAAGDDQRRTRQRRASPTPPNHGPASGPIPGMAHAREH*
Coding >Ophun1|6003
ATGGACCCCATCAACTATCTTCCCCCCGGCACTGGCCCCAGGCTGCCTCATCACGGCGATGGACATACCGCTTCG
TGGGCTCCCTCTCATCAGACCCATCCCCGACTTCCACCCACGGCTCCTTGGCCTGCCAGCTCGGCCGTCTCGACG
TCACCACTCTACTTTGGTCCTTCAGCCCAACAGCAGCAGCTTGAGCAGCAGCAACAACAACAACAACAGCAGCAG
CAGCAGCAGCAGCACCCCAGACCGCCTCAGCTTGGTCGTTCGTTGTCACCGTCGCCATCCTTCGGTCTCGGCTTG
CAGGGCTCGCTGCCTCATCCCGACGCCGGACTACGAGGGGTCCAGCCACAGAACTCCGATGGGCTCTTCACGCCA
GCTCGGCTGCACTCGTTCGCCTCGATAGGTCAGGCCGGTCTTGTCCTCCATCCGGCTGGCTTCGGGCCCCCCCCT
GGCCTTGGCCCGCAGCCTCCGACGCTGGGACCCGGCCGCGGCGAGGCTGGCCGCGGCGAATTGCCCATCTTCCCC
CTCGCCGAGCCGCTGCCGAACCCCTACGGGCCCCGGAACCTGTCGGGTCACCCTTACAGCTTGGCCTATCCTCGT
CGTTCGGGCTCCGTTGCGTCTGTGTCGGCAGGGCCTCGCTTTCTGCAGCCGGCTGCAGCCGTGTCTGGAAATGCT
CCTGTACCGTCCACCACTTCCACTCGCAACACTTCGGCCCTACCGTCGCCCATCACGGACCGGCGCCGCCAAGGC
CTCTCGAGGGCCCGTCGGTACCTCACCTCGCGGCATTCGGCCCCGGACGCCGTCCAGGACACCGCTGTCATGGCC
GAAGTCGCCGATGGCAGACTGAGCCGTCACCCTGGCCACAACCTCACCGAGCACCTCAACTACGTGATTCCGGAC
GACGCGGCTCTGCGACAGCTGCAGTTGGCTAGAGGCGCCATTCCCAGCAAGCTGATTGCTTCGACCGTCGCCCTC
CAGAGTTTGCAGGTCGTCGACGTCAAGTCACTGTCGGCCAACGAGCGGATGTGTGTCATCTGCTACAACGACTAC
GGTGTTCAGAGCATCGAGGGCGTTGTCGAGGCTCCTCTACGCCTGCCCAACTGCAAACACGTCTTCGGCAACCAG
TGCATTAAGAAGTGGCTCGAGGACTCGGACAGCTGTCCCTACTGCCGTGACAAGCTGCCGTCGGAGCCAAAGGTC
GGCCAGACGACGGCGGCTGGTCACGCTTTCATGACGCTCCTGAGGAGACGAGACTCGCAAGCCAGCTCTCCAGAG
GGTTATTATCGCCGCATGCTGAGCAGGTTCAGGTCAGGAGAACTTGTCGAGCTCGGCCTTAGGCACGGCCGCGCC
GCAGAGAGGCGATCTCCCCCGGCCGACGCCGCCGGCGATGACCAGCGTCGGACGCGCCAGAGGAGGGCCAGCCCG
ACGCCCCCCAACCACGGTCCGGCCTCGGGTCCCATACCGGGAATGGCCCACGCGCGGGAACACTGA
Transcript >Ophun1|6003
ATGGACCCCATCAACTATCTTCCCCCCGGCACTGGCCCCAGGCTGCCTCATCACGGCGATGGACATACCGCTTCG
TGGGCTCCCTCTCATCAGACCCATCCCCGACTTCCACCCACGGCTCCTTGGCCTGCCAGCTCGGCCGTCTCGACG
TCACCACTCTACTTTGGTCCTTCAGCCCAACAGCAGCAGCTTGAGCAGCAGCAACAACAACAACAACAGCAGCAG
CAGCAGCAGCAGCACCCCAGACCGCCTCAGCTTGGTCGTTCGTTGTCACCGTCGCCATCCTTCGGTCTCGGCTTG
CAGGGCTCGCTGCCTCATCCCGACGCCGGACTACGAGGGGTCCAGCCACAGAACTCCGATGGGCTCTTCACGCCA
GCTCGGCTGCACTCGTTCGCCTCGATAGGTCAGGCCGGTCTTGTCCTCCATCCGGCTGGCTTCGGGCCCCCCCCT
GGCCTTGGCCCGCAGCCTCCGACGCTGGGACCCGGCCGCGGCGAGGCTGGCCGCGGCGAATTGCCCATCTTCCCC
CTCGCCGAGCCGCTGCCGAACCCCTACGGGCCCCGGAACCTGTCGGGTCACCCTTACAGCTTGGCCTATCCTCGT
CGTTCGGGCTCCGTTGCGTCTGTGTCGGCAGGGCCTCGCTTTCTGCAGCCGGCTGCAGCCGTGTCTGGAAATGCT
CCTGTACCGTCCACCACTTCCACTCGCAACACTTCGGCCCTACCGTCGCCCATCACGGACCGGCGCCGCCAAGGC
CTCTCGAGGGCCCGTCGGTACCTCACCTCGCGGCATTCGGCCCCGGACGCCGTCCAGGACACCGCTGTCATGGCC
GAAGTCGCCGATGGCAGACTGAGCCGTCACCCTGGCCACAACCTCACCGAGCACCTCAACTACGTGATTCCGGAC
GACGCGGCTCTGCGACAGCTGCAGTTGGCTAGAGGCGCCATTCCCAGCAAGCTGATTGCTTCGACCGTCGCCCTC
CAGAGTTTGCAGGTCGTCGACGTCAAGTCACTGTCGGCCAACGAGCGGATGTGTGTCATCTGCTACAACGACTAC
GGTGTTCAGAGCATCGAGGGCGTTGTCGAGGCTCCTCTACGCCTGCCCAACTGCAAACACGTCTTCGGCAACCAG
TGCATTAAGAAGTGGCTCGAGGACTCGGACAGCTGTCCCTACTGCCGTGACAAGCTGCCGTCGGAGCCAAAGGTC
GGCCAGACGACGGCGGCTGGTCACGCTTTCATGACGCTCCTGAGGAGACGAGACTCGCAAGCCAGCTCTCCAGAG
GGTTATTATCGCCGCATGCTGAGCAGGTTCAGGTCAGGAGAACTTGTCGAGCTCGGCCTTAGGCACGGCCGCGCC
GCAGAGAGGCGATCTCCCCCGGCCGACGCCGCCGGCGATGACCAGCGTCGGACGCGCCAGAGGAGGGCCAGCCCG
ACGCCCCCCAACCACGGTCCGGCCTCGGGTCCCATACCGGGAATGGCCCACGCGCGGGAACACTGA
Gene >Ophun1|6003
ATGGACCCCATCAACTATCTTCCCCCCGGCACTGGCCCCAGGCTGCCTCATCACGGCGATGGACATACCGCTTCG
TGGGCTCCCTCTCATCAGACCCATCCCCGACTTCCACCCACGGCTCCTTGGCCTGCCAGCTCGGCCGTCTCGACG
TCACCACTCTACTTTGGTCCTTCAGCCCAACAGCAGCAGCTTGAGCAGCAGCAACAACAACAACAACAGCAGCAG
CAGCAGCAGCAGCACCCCAGACCGCCTCAGCTTGGTCGTTCGTTGTCACCGTCGCCATCCTTCGGTCTCGGCTTG
CAGGGCTCGCTGCCTCATCCCGACGCCGGACTACGAGGGGTCCAGCCACAGAACTCCGATGGGCTCTTCACGCCA
GCTCGGCTGCACTCGTTCGCCTCGATAGGTCAGGCCGGTCTTGTCCTCCATCCGGCTGGCTTCGGGCCCCCCCCT
GGCCTTGGCCCGCAGCCTCCGACGCTGGGACCCGGCCGCGGCGAGGCTGGCCGCGGCGAATTGCCCATCTTCCCC
CTCGCCGAGCCGCTGCCGAACCCCTACGGGCCCCGGAACCTGTCGGGTCACCCTTACAGCTTGGCCTATCCTCGT
CGTTCGGGCTCCGTTGCGTCTGTGTCGGCAGGGCCTCGCTTTCTGCAGCCGGCTGCAGCCGTGTCTGGAAATGGT
GAGTCTTCTCTCTCTGCCTTTAACTCGGCGTCTTCAGCTCTGCCTGTGTTCCGTCATTTTGTTTTTCTTTTCTCT
TCTTTGCTCTTCTCTCCCCCTCCCCTCTTCTCAACCTTTTTTTTTTTCTTGTTTTGCCTCGTGCCTCGCTTTTGT
CTCCGCTTCTACCGCTTACCTCTGCCTTTGCATCTGCCACTGCCACTCCTCACCGCTTCTGTCTGCTGAATCACA
TACTCTATCTTCACTTTCCTCTCCTCCGCACACAAGCTCTTCGCACAATTTTTTCCCCCATTGTTTCACTTCAAC
TGACCGTTGCCATCGAGAAGCTCCTGTACCGTCCACCACTTCCACTCGCAACACTTCGGCCCTACCGTCGCCCAT
CACGGACCGGCGCCGCCAAGGCCTCTCGAGGGCCCGTCGGTACCTCACCTCGCGGCATTCGGCCCCGGACGCCGT
CCAGGACACCGCTGTCATGGCCGAAGTCGCCGATGGCAGACTGAGCCGTCACCCTGGCCACAACCTCACCGAGCA
CCTCAACTACGTGATTCCGGACGACGCGGCTCTGCGACAGCTGCAGTTGGCTAGAGGCGCCATTCCCAGCAAGCT
GATTGCTTCGACCGTCGCCCTCCAGAGTTTGCAGGTCGTCGACGTCAAGTCACTGTCGGCCAACGAGCGGAGTGA
GTAGATGACGTTGGCCTTGTTTTCTTCTTTCATGTCTAAGCTCACGCTCGTCACAGTGTGTGTCATCTGCTACAA
CGACTACGGTGTTCAGAGCATCGAGGGCGTTGTCGAGGCTCCTCTACGCCTGCCCAACTGCAAACACGTCTTCGG
CAACCAGTGCATTAAGAAGTGGCTCGAGGACTCGGACAGCTGTCCCTACTGCCGTGACAAGCTGCCGTCGGAGCC
AAAGGTCGGCCAGACGACGGCGGCTGGTCACGCTTTCATGACGCTCCTGAGGAGACGAGACTCGCAAGCGTGAGT
GGTTTTCCCCTTGATATCTCTCAAGAGTGCTCACAAACTCCCCTGCAGCAGCTCTCCAGAGGGTTATTATCGCCG
CATGCTGAGCAGGTTCAGGTCAGGAGAACTTGTCGAGCTCGGCCTTAGGCACGGCCGCGCCGCAGAGAGGCGATC
TCCCCCGGCCGACGCCGCCGGCGATGACCAGCGTCGGACGCGCCAGAGGAGGGCCAGCCCGACGCCCCCCAACCA
CGGTCCGGCCTCGGGTCCCATACCGGGAATGGCCCACGCGCGGGAACACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail