Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6002
Gene name
LocationContig_624:3076..5668
Strand+
Gene length (bp)2592
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2 2.8E-20 802 860
PF00888 Cullin Cullin family 4.2E-18 512 719

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q874R3|APC2_SCHPO Anaphase-promoting complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc2 PE=1 SV=1 207 860 5.0E-65
sp|Q9UJX6|ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens GN=ANAPC2 PE=1 SV=1 325 863 3.0E-61
sp|Q8BZQ7|ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus GN=Anapc2 PE=1 SV=2 325 863 2.0E-58
sp|Q8H1U5|APC2_ARATH Anaphase-promoting complex subunit 2 OS=Arabidopsis thaliana GN=APC2 PE=1 SV=1 320 862 1.0E-57
sp|Q551S9|APC2_DICDI Anaphase-promoting complex subunit 2 OS=Dictyostelium discoideum GN=anapc2 PE=3 SV=1 338 862 1.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q874R3|APC2_SCHPO Anaphase-promoting complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc2 PE=1 SV=1 207 860 5.0E-65
sp|Q9UJX6|ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens GN=ANAPC2 PE=1 SV=1 325 863 3.0E-61
sp|Q8BZQ7|ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus GN=Anapc2 PE=1 SV=2 325 863 2.0E-58
sp|Q8H1U5|APC2_ARATH Anaphase-promoting complex subunit 2 OS=Arabidopsis thaliana GN=APC2 PE=1 SV=1 320 862 1.0E-57
sp|Q551S9|APC2_DICDI Anaphase-promoting complex subunit 2 OS=Dictyostelium discoideum GN=anapc2 PE=3 SV=1 338 862 1.0E-50
sp|P34514|ANC2_CAEEL Anaphase-promoting complex subunit 2 OS=Caenorhabditis elegans GN=apc-2 PE=1 SV=3 364 660 3.0E-26
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul4 PE=1 SV=1 511 688 7.0E-09
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul3 PE=1 SV=2 513 680 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006508 proteolysis No
GO:0009056 catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0019899 enzyme binding No
GO:0009057 macromolecule catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1676
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6254
Ophiocordyceps australis map64 (Brazil) OphauB2|3162
Ophiocordyceps camponoti-floridani Ophcf2|07279
Ophiocordyceps camponoti-rufipedis Ophun1|6002 (this protein)
Ophiocordyceps kimflemingae Ophio5|2050
Ophiocordyceps subramaniannii Hirsu2|1430

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6002
MMMMTTTTTMRARRAKVFHSVFQPDATPLKSGSRRRPSASGDDERSQVAVGSDQVRWDRAWEVVTSRIQLPTSVA
AEDSFGTIPSQSQVADDDLFSDALAIVLDPAGAVPRAVGTGDVLLWHSHQVRQHFVHHVLPLLAACAARDDASEV
LLSSAQTLQAAHRQYSYGLTLVVGGIRQRHVREAAVAGFRRELHALVSSSWATGLTAALRTVLTRLLSDVLMVDV
GGEPSKVRVEGASRALAELLSLLESLQTMGLAGDSLHVLLAEIMDGRMSDFIDCAYAGVWAASTSCVDHLRGWID
DHYGRVAAQVLACLGGRVSAEDVDRWREVAVGRLAALRTSELFDMVLEWPRSRGGLDDLRLAVTTPRRRLQLTDA
FSAALQKRLLHPGRSTLSILQTYIAMIRTFHALDASKVLLDRVAHALQLYLCQRDDAIRIVVTGLLANPKAADEE
EGGRDTRLVELAAILSDASQQRIGRSGGGGDDDMDWNDMSWVPDPVDAGVNYKRPKSEDVIGTLISALGSHDIFI
KEFQLIVAERLLSRQTDFRQEVKVLGLLKKRFGEAALQNCDVMIKDIYDSRRVDATICRNLAAARGLPSYHSKIL
SRLFWPSLRREGFRVPGPVAAAKTRYEAGFEQLKTARKLGWLCHLGSAAVRLELEDRSVDVECSTYEAAVIYAFG
EDGEGGSGQGTRRWKFDELWQHLTMDEDLLVLALNFWLSKRVLRDVGDQTYEVMERLGGQGSSTTTEAMTTTMTT
STTTTTTTNTNTTSTTMARGGQGQGDGPPLRKAKRLVDSAREKERRAVYWQFIVGMLTNSSPAMPLGQISMMMKM
LLSDGCPWSNEELQDFLGERVSGGELELVGGKYRLAKK*
Coding >Ophun1|6002
ATGATGATGATGACGACGACGACGACGATGCGGGCGCGCAGGGCCAAGGTCTTTCACTCGGTCTTTCAGCCTGAT
GCTACGCCGCTGAAATCCGGCTCGCGACGCCGCCCCTCTGCCTCCGGCGATGACGAGCGGTCACAGGTGGCTGTC
GGCAGCGATCAGGTTCGATGGGACCGCGCCTGGGAGGTGGTGACGTCGCGTATCCAGCTGCCGACGTCGGTGGCG
GCCGAGGACTCGTTCGGCACCATCCCTTCCCAGTCGCAGGTGGCCGACGACGACTTATTCAGCGACGCGCTGGCC
ATCGTCCTGGATCCGGCCGGTGCGGTCCCGCGGGCTGTCGGCACGGGCGACGTCTTGCTGTGGCACTCTCATCAG
GTTCGGCAGCACTTTGTCCACCACGTCTTGCCGCTGCTGGCTGCCTGCGCCGCCCGCGACGACGCGTCCGAGGTT
CTTCTCAGCAGCGCGCAGACTCTGCAGGCGGCTCACCGGCAGTACTCGTACGGCCTGACGCTTGTGGTTGGCGGC
ATTCGCCAGCGTCATGTGCGGGAGGCGGCTGTGGCTGGCTTCCGGCGGGAGCTACACGCTCTCGTTAGCAGTTCG
TGGGCTACGGGGCTGACGGCTGCGTTGCGGACGGTGCTTACGCGCCTGTTGTCTGATGTGTTGATGGTTGATGTT
GGCGGGGAGCCGAGCAAGGTTCGGGTTGAGGGCGCTTCTCGTGCGCTTGCTGAGCTGCTCTCGCTGCTGGAGTCG
TTGCAGACTATGGGCTTGGCGGGCGACTCGCTTCACGTGCTTCTGGCTGAGATTATGGACGGCAGGATGAGCGAC
TTTATCGACTGTGCCTACGCTGGCGTCTGGGCTGCGTCCACGTCGTGTGTTGACCATCTTCGCGGCTGGATCGAT
GACCACTACGGCCGGGTCGCTGCTCAGGTGCTGGCCTGTCTCGGTGGTCGCGTCTCGGCCGAGGATGTCGACCGC
TGGAGGGAGGTGGCTGTTGGAAGGCTGGCGGCGTTGCGAACCAGCGAGCTCTTCGACATGGTGCTGGAATGGCCG
AGGAGTCGGGGCGGGCTCGATGATCTGCGTTTGGCCGTGACGACGCCCCGACGACGGCTGCAGCTTACCGACGCC
TTCTCGGCTGCGCTGCAGAAGCGGCTGCTCCATCCGGGCCGGTCGACGCTGTCGATACTGCAGACGTACATTGCC
ATGATTCGCACATTTCACGCTCTCGACGCGTCCAAGGTGCTGCTGGATCGGGTGGCTCACGCGCTGCAGCTGTAC
CTGTGTCAGCGGGATGACGCCATCCGCATCGTCGTTACGGGCCTCCTGGCCAACCCAAAGGCGGCTGACGAGGAG
GAAGGGGGTCGTGACACTAGGCTCGTCGAGCTGGCGGCTATCCTCAGCGACGCCTCGCAACAGCGGATCGGACGG
AGCGGTGGCGGTGGCGACGATGACATGGACTGGAACGACATGAGCTGGGTGCCGGATCCCGTCGATGCCGGCGTC
AACTACAAGCGACCGAAGAGCGAGGACGTCATCGGCACCCTCATCAGCGCCCTCGGCTCGCACGACATCTTCATC
AAGGAGTTTCAGCTCATCGTCGCCGAGCGGCTGCTGTCGCGGCAGACGGACTTTCGACAGGAGGTCAAGGTGCTG
GGCCTGCTTAAGAAGCGCTTCGGCGAGGCGGCGCTGCAAAACTGCGACGTCATGATCAAGGACATTTACGACTCG
AGGCGCGTCGACGCCACCATCTGCAGGAACCTGGCGGCGGCGCGGGGATTGCCGTCGTACCACTCCAAGATTCTG
TCTCGCCTCTTCTGGCCCAGCCTCCGAAGGGAGGGGTTCCGGGTCCCGGGTCCGGTGGCGGCGGCCAAGACACGG
TACGAGGCTGGCTTTGAGCAGCTCAAGACGGCGAGGAAGTTGGGGTGGCTCTGTCACCTTGGGTCTGCGGCCGTC
CGGCTCGAGCTGGAGGATCGGTCGGTGGATGTCGAGTGCAGCACGTACGAGGCCGCCGTCATCTACGCCTTTGGT
GAGGATGGGGAGGGTGGGAGTGGTCAGGGGACGCGGAGGTGGAAGTTTGATGAGCTGTGGCAGCATCTCACCATG
GATGAGGATCTGCTGGTGCTGGCTCTCAACTTTTGGCTGTCTAAGCGGGTGTTGCGAGACGTTGGGGATCAGACG
TACGAGGTGATGGAGAGGCTGGGCGGCCAAGGGAGCAGCACGACGACGGAGGCGATGACTACGACGATGACGACT
TCAACGACGACGACTACGACGACAAACACGAACACGACTTCGACGACGATGGCGCGGGGAGGCCAAGGGCAAGGC
GACGGGCCGCCGCTGCGGAAGGCGAAGCGGCTCGTCGACTCGGCGCGGGAAAAGGAGAGGCGGGCCGTTTACTGG
CAGTTCATCGTGGGCATGCTGACCAACTCGAGCCCAGCGATGCCACTGGGCCAGATATCGATGATGATGAAGATG
CTCCTGTCGGACGGGTGCCCCTGGAGCAACGAGGAGTTGCAGGACTTTCTGGGCGAGAGGGTTTCTGGCGGCGAG
TTGGAGCTCGTGGGCGGCAAGTATCGGCTGGCCAAGAAATGA
Transcript >Ophun1|6002
ATGATGATGATGACGACGACGACGACGATGCGGGCGCGCAGGGCCAAGGTCTTTCACTCGGTCTTTCAGCCTGAT
GCTACGCCGCTGAAATCCGGCTCGCGACGCCGCCCCTCTGCCTCCGGCGATGACGAGCGGTCACAGGTGGCTGTC
GGCAGCGATCAGGTTCGATGGGACCGCGCCTGGGAGGTGGTGACGTCGCGTATCCAGCTGCCGACGTCGGTGGCG
GCCGAGGACTCGTTCGGCACCATCCCTTCCCAGTCGCAGGTGGCCGACGACGACTTATTCAGCGACGCGCTGGCC
ATCGTCCTGGATCCGGCCGGTGCGGTCCCGCGGGCTGTCGGCACGGGCGACGTCTTGCTGTGGCACTCTCATCAG
GTTCGGCAGCACTTTGTCCACCACGTCTTGCCGCTGCTGGCTGCCTGCGCCGCCCGCGACGACGCGTCCGAGGTT
CTTCTCAGCAGCGCGCAGACTCTGCAGGCGGCTCACCGGCAGTACTCGTACGGCCTGACGCTTGTGGTTGGCGGC
ATTCGCCAGCGTCATGTGCGGGAGGCGGCTGTGGCTGGCTTCCGGCGGGAGCTACACGCTCTCGTTAGCAGTTCG
TGGGCTACGGGGCTGACGGCTGCGTTGCGGACGGTGCTTACGCGCCTGTTGTCTGATGTGTTGATGGTTGATGTT
GGCGGGGAGCCGAGCAAGGTTCGGGTTGAGGGCGCTTCTCGTGCGCTTGCTGAGCTGCTCTCGCTGCTGGAGTCG
TTGCAGACTATGGGCTTGGCGGGCGACTCGCTTCACGTGCTTCTGGCTGAGATTATGGACGGCAGGATGAGCGAC
TTTATCGACTGTGCCTACGCTGGCGTCTGGGCTGCGTCCACGTCGTGTGTTGACCATCTTCGCGGCTGGATCGAT
GACCACTACGGCCGGGTCGCTGCTCAGGTGCTGGCCTGTCTCGGTGGTCGCGTCTCGGCCGAGGATGTCGACCGC
TGGAGGGAGGTGGCTGTTGGAAGGCTGGCGGCGTTGCGAACCAGCGAGCTCTTCGACATGGTGCTGGAATGGCCG
AGGAGTCGGGGCGGGCTCGATGATCTGCGTTTGGCCGTGACGACGCCCCGACGACGGCTGCAGCTTACCGACGCC
TTCTCGGCTGCGCTGCAGAAGCGGCTGCTCCATCCGGGCCGGTCGACGCTGTCGATACTGCAGACGTACATTGCC
ATGATTCGCACATTTCACGCTCTCGACGCGTCCAAGGTGCTGCTGGATCGGGTGGCTCACGCGCTGCAGCTGTAC
CTGTGTCAGCGGGATGACGCCATCCGCATCGTCGTTACGGGCCTCCTGGCCAACCCAAAGGCGGCTGACGAGGAG
GAAGGGGGTCGTGACACTAGGCTCGTCGAGCTGGCGGCTATCCTCAGCGACGCCTCGCAACAGCGGATCGGACGG
AGCGGTGGCGGTGGCGACGATGACATGGACTGGAACGACATGAGCTGGGTGCCGGATCCCGTCGATGCCGGCGTC
AACTACAAGCGACCGAAGAGCGAGGACGTCATCGGCACCCTCATCAGCGCCCTCGGCTCGCACGACATCTTCATC
AAGGAGTTTCAGCTCATCGTCGCCGAGCGGCTGCTGTCGCGGCAGACGGACTTTCGACAGGAGGTCAAGGTGCTG
GGCCTGCTTAAGAAGCGCTTCGGCGAGGCGGCGCTGCAAAACTGCGACGTCATGATCAAGGACATTTACGACTCG
AGGCGCGTCGACGCCACCATCTGCAGGAACCTGGCGGCGGCGCGGGGATTGCCGTCGTACCACTCCAAGATTCTG
TCTCGCCTCTTCTGGCCCAGCCTCCGAAGGGAGGGGTTCCGGGTCCCGGGTCCGGTGGCGGCGGCCAAGACACGG
TACGAGGCTGGCTTTGAGCAGCTCAAGACGGCGAGGAAGTTGGGGTGGCTCTGTCACCTTGGGTCTGCGGCCGTC
CGGCTCGAGCTGGAGGATCGGTCGGTGGATGTCGAGTGCAGCACGTACGAGGCCGCCGTCATCTACGCCTTTGGT
GAGGATGGGGAGGGTGGGAGTGGTCAGGGGACGCGGAGGTGGAAGTTTGATGAGCTGTGGCAGCATCTCACCATG
GATGAGGATCTGCTGGTGCTGGCTCTCAACTTTTGGCTGTCTAAGCGGGTGTTGCGAGACGTTGGGGATCAGACG
TACGAGGTGATGGAGAGGCTGGGCGGCCAAGGGAGCAGCACGACGACGGAGGCGATGACTACGACGATGACGACT
TCAACGACGACGACTACGACGACAAACACGAACACGACTTCGACGACGATGGCGCGGGGAGGCCAAGGGCAAGGC
GACGGGCCGCCGCTGCGGAAGGCGAAGCGGCTCGTCGACTCGGCGCGGGAAAAGGAGAGGCGGGCCGTTTACTGG
CAGTTCATCGTGGGCATGCTGACCAACTCGAGCCCAGCGATGCCACTGGGCCAGATATCGATGATGATGAAGATG
CTCCTGTCGGACGGGTGCCCCTGGAGCAACGAGGAGTTGCAGGACTTTCTGGGCGAGAGGGTTTCTGGCGGCGAG
TTGGAGCTCGTGGGCGGCAAGTATCGGCTGGCCAAGAAATGA
Gene >Ophun1|6002
ATGATGATGATGACGACGACGACGACGATGCGGGCGCGCAGGGCCAAGGTCTTTCACTCGGTCTTTCAGCCTGAT
GCTACGCCGCTGAAATCCGGCTCGCGACGCCGCCCCTCTGCCTCCGGCGATGACGAGCGGTCACAGGTGGCTGTC
GGCAGCGATCAGGTTCGATGGGACCGCGCCTGGGAGGTGGTGACGTCGCGTATCCAGCTGCCGACGTCGGTGGCG
GCCGAGGACTCGTTCGGCACCATCCCTTCCCAGTCGCAGGTGGCCGACGACGACTTATTCAGCGACGCGCTGGCC
ATCGTCCTGGATCCGGCCGGTGCGGTCCCGCGGGCTGTCGGCACGGGCGACGTCTTGCTGTGGCACTCTCATCAG
GTTCGGCAGCACTTTGTCCACCACGTCTTGCCGCTGCTGGCTGCCTGCGCCGCCCGCGACGACGCGTCCGAGGTT
CTTCTCAGCAGCGCGCAGACTCTGCAGGCGGCTCACCGGCAGTACTCGTACGGCCTGACGCTTGTGGTTGGCGGC
ATTCGCCAGCGTCATGTGCGGGAGGCGGCTGTGGCTGGCTTCCGGCGGGAGCTACACGCTCTCGTTAGCAGTTCG
TGGGCTACGGGGCTGACGGCTGCGTTGCGGACGGTGCTTACGCGCCTGTTGTCTGATGTGTTGATGGTTGATGTT
GGCGGGGAGCCGAGCAAGGTTCGGGTTGAGGGCGCTTCTCGTGCGCTTGCTGAGCTGCTCTCGCTGCTGGAGTCG
TTGCAGACTATGGGCTTGGCGGGCGACTCGCTTCACGTGCTTCTGGCTGAGATTATGGACGGCAGGATGAGCGAC
TTTATCGACTGTGCCTACGCTGGCGTCTGGGCTGCGTCCACGTCGTGTGTTGACCATCTTCGCGGCTGGATCGAT
GACCACTACGGCCGGGTCGCTGCTCAGGTGCTGGCCTGTCTCGGTGGTCGCGTCTCGGCCGAGGATGTCGACCGC
TGGAGGGAGGTGGCTGTTGGAAGGCTGGCGGCGTTGCGAACCAGCGAGCTCTTCGACATGGTGCTGGAATGGCCG
AGGAGTCGGGGCGGGCTCGATGATCTGCGTTTGGCCGTGACGACGCCCCGACGACGGCTGCAGCTTACCGACGCC
TTCTCGGCTGCGCTGCAGAAGCGGCTGCTCCATCCGGGCCGGTCGACGCTGTCGATACTGCAGACGTACATTGCC
ATGATTCGCACATTTCACGCTCTCGACGCGTCCAAGGTGCTGCTGGATCGGGTGGCTCACGCGCTGCAGCTGTAC
CTGTGTCAGCGGGATGACGCCATCCGCATCGTCGTTACGGGCCTCCTGGCCAACCCAAAGGCGGCTGACGAGGAG
GAAGGGGGTCGTGACACTAGGCTCGTCGAGCTGGCGGCTATCCTCAGCGACGCCTCGCAACAGCGGATCGGACGG
AGCGGTGGCGGTGGCGACGATGACATGGACTGGAACGACATGAGCTGGGTGCCGGATCCCGTCGATGCCGGCGTC
AACTACAAGCGACCGAAGAGCGAGGACGTCATCGGCACCCTCATCAGCGCCCTCGGCTCGCACGACATCTTCATC
AAGGAGTTTCAGCTCATCGTCGCCGAGCGGCTGCTGTCGCGGCAGACGGACTTTCGACAGGAGGTCAAGGTGCTG
GGCCTGCTTAAGAAGCGCTTCGGCGAGGCGGCGCTGCAAAACTGCGACGTCATGATCAAGGACATTTACGACTCG
AGGCGCGTCGACGCCACCATCTGCAGGAACCTGGCGGCGGCGCGGGGATTGCCGTCGTACCACTCCAAGATTCTG
TCTCGCCTCTTCTGGCCCAGCCTCCGAAGGGAGGGGTTCCGGGTCCCGGGTCCGGTGGCGGCGGCCAAGACACGG
TACGAGGCTGGCTTTGAGCAGCTCAAGACGGCGAGGAAGTTGGGGTGGCTCTGTCACCTTGGGTCTGCGGCCGTC
CGGCTCGAGCTGGAGGATCGGTCGGTGGATGTCGAGTGCAGCACGTACGAGGCCGCCGTCATCTACGCCTTTGGT
GAGGATGGGGAGGGTGGGAGTGGTCAGGGGACGCGGAGGTGGAAGTTTGATGAGCTGTGGCAGCATCTCACCATG
GATGAGGATCTGCTGGTGCTGGCTCTCAACTTTTGGCTGTCTAAGCGGGTGTTGCGAGACGTTGGGGATCAGACG
TACGAGGTGATGGAGAGGCTGGGCGGCCAAGGGAGCAGCACGACGACGGAGGCGATGACTACGACGATGACGACT
TCAACGACGACGACTACGACGACAAACACGAACACGACTTCGACGACGATGGCGCGGGGAGGCCAAGGGCAAGGC
GACGGGCCGCCGCTGCGGAAGGCGAAGCGGCTCGTCGACTCGGCGCGGGAAAAGGAGAGGCGGGCCGTTTACTGG
CAGTTCATCGTGGGCATGCTGACCAACTCGAGCCCAGCGATGCCACTGGGCCAGATATCGATGATGATGAAGATG
CTCCTGTCGGACGGGTGCCCCTGGAGCAACGAGGAGTTGCAGGACTTTCTGGGCGAGAGGGTTTCTGGCGGCGAG
TTGGAGCTCGTGGGCGGCAAGTATCGGCTGGCCAAGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail