Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5995
Gene name
LocationContig_622:1149..3504
Strand-
Gene length (bp)2355
Transcript length (bp)2241
Coding sequence length (bp)2241
Protein length (aa) 747

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08662 eIF2A Eukaryotic translation initiation factor eIF2A 4.6E-35 405 627

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10425|EIF3B_SCHPO Eukaryotic translation initiation factor 3 subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.08 PE=1 SV=1 20 718 0.0E+00
sp|Q7S464|EIF3B_NEUCR Eukaryotic translation initiation factor 3 subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prt-1 PE=3 SV=1 1 730 0.0E+00
sp|Q5AGV4|EIF3B_CANAL Eukaryotic translation initiation factor 3 subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRT1 PE=3 SV=1 15 687 0.0E+00
sp|A5DR43|EIF3B_PICGU Eukaryotic translation initiation factor 3 subunit B OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRT1 PE=3 SV=2 21 687 0.0E+00
sp|A5E5Y8|EIF3B_LODEL Eukaryotic translation initiation factor 3 subunit B OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRT1 PE=3 SV=1 22 687 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10425|EIF3B_SCHPO Eukaryotic translation initiation factor 3 subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.08 PE=1 SV=1 20 718 0.0E+00
sp|Q7S464|EIF3B_NEUCR Eukaryotic translation initiation factor 3 subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prt-1 PE=3 SV=1 1 730 0.0E+00
sp|Q5AGV4|EIF3B_CANAL Eukaryotic translation initiation factor 3 subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRT1 PE=3 SV=1 15 687 0.0E+00
sp|A5DR43|EIF3B_PICGU Eukaryotic translation initiation factor 3 subunit B OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRT1 PE=3 SV=2 21 687 0.0E+00
sp|A5E5Y8|EIF3B_LODEL Eukaryotic translation initiation factor 3 subunit B OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRT1 PE=3 SV=1 22 687 0.0E+00
sp|Q6BLY5|EIF3B_DEBHA Eukaryotic translation initiation factor 3 subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRT1 PE=3 SV=2 15 687 0.0E+00
sp|A3LY29|EIF3B_PICST Eukaryotic translation initiation factor 3 subunit B OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRT1 PE=3 SV=1 17 687 0.0E+00
sp|Q4P6G4|EIF3B_USTMA Eukaryotic translation initiation factor 3 subunit B OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRT1 PE=3 SV=1 3 720 0.0E+00
sp|Q6C1H8|EIF3B_YARLI Eukaryotic translation initiation factor 3 subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRT1 PE=3 SV=1 22 718 0.0E+00
sp|Q1DI97|EIF3B_COCIM Eukaryotic translation initiation factor 3 subunit B OS=Coccidioides immitis (strain RS) GN=PRT1 PE=3 SV=1 1 704 0.0E+00
sp|A1D558|EIF3B_NEOFI Eukaryotic translation initiation factor 3 subunit B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prt1 PE=3 SV=1 1 721 0.0E+00
sp|A4QZL9|EIF3B_MAGO7 Eukaryotic translation initiation factor 3 subunit B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRT1 PE=3 SV=1 1 723 0.0E+00
sp|Q2GM53|EIF3B_CHAGB Eukaryotic translation initiation factor 3 subunit B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRT1 PE=3 SV=1 1 724 0.0E+00
sp|B0XRG7|EIF3B_ASPFC Eukaryotic translation initiation factor 3 subunit B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=prt1 PE=3 SV=1 1 721 0.0E+00
sp|A7EHM8|EIF3B_SCLS1 Eukaryotic translation initiation factor 3 subunit B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prt1 PE=3 SV=1 1 711 0.0E+00
sp|A6SFQ6|EIF3B_BOTFB Eukaryotic translation initiation factor 3 subunit B OS=Botryotinia fuckeliana (strain B05.10) GN=prt1 PE=3 SV=1 1 711 0.0E+00
sp|Q0CN46|EIF3B_ASPTN Eukaryotic translation initiation factor 3 subunit B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prt1 PE=3 SV=1 1 704 0.0E+00
sp|A2Q908|EIF3B_ASPNC Eukaryotic translation initiation factor 3 subunit B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prt1 PE=3 SV=1 1 706 0.0E+00
sp|A1CS92|EIF3B_ASPCL Eukaryotic translation initiation factor 3 subunit B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prt1 PE=3 SV=1 1 706 0.0E+00
sp|Q5BGH1|EIF3B_EMENI Eukaryotic translation initiation factor 3 subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prt1 PE=3 SV=1 1 710 0.0E+00
sp|Q2URB7|EIF3B_ASPOR Eukaryotic translation initiation factor 3 subunit B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prt1 PE=3 SV=1 1 706 0.0E+00
sp|Q4WKL7|EIF3B_ASPFU Eukaryotic translation initiation factor 3 subunit B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prt1 PE=3 SV=1 1 721 0.0E+00
sp|P0CN44|EIF3B_CRYNJ Eukaryotic translation initiation factor 3 subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRT1 PE=3 SV=1 14 744 6.0E-178
sp|P0CN45|EIF3B_CRYNB Eukaryotic translation initiation factor 3 subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRT1 PE=3 SV=1 14 744 6.0E-178
sp|Q758X9|EIF3B_ASHGO Eukaryotic translation initiation factor 3 subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRT1 PE=3 SV=1 1 696 9.0E-158
sp|A7MB16|EIF3B_BOVIN Eukaryotic translation initiation factor 3 subunit B OS=Bos taurus GN=EIF3B PE=2 SV=1 16 705 8.0E-155
sp|Q8JZQ9|EIF3B_MOUSE Eukaryotic translation initiation factor 3 subunit B OS=Mus musculus GN=Eif3b PE=1 SV=1 16 687 1.0E-154
sp|Q4G061|EIF3B_RAT Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus GN=Eif3b PE=1 SV=1 16 687 2.0E-154
sp|P55884|EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens GN=EIF3B PE=1 SV=3 16 705 2.0E-154
sp|Q6CY34|EIF3B_KLULA Eukaryotic translation initiation factor 3 subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRT1 PE=3 SV=1 21 699 5.0E-154
sp|Q569Z1|EIF3B_XENLA Eukaryotic translation initiation factor 3 subunit B OS=Xenopus laevis GN=eif3b PE=2 SV=1 39 734 3.0E-150
sp|A7TKF2|EIF3B_VANPO Eukaryotic translation initiation factor 3 subunit B OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRT1 PE=3 SV=1 21 697 3.0E-146
sp|P56821|EIF3B_TOBAC Eukaryotic translation initiation factor 3 subunit B OS=Nicotiana tabacum GN=TIF3B1 PE=2 SV=1 24 698 6.0E-143
sp|P06103|EIF3B_YEAST Eukaryotic translation initiation factor 3 subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRT1 PE=1 SV=1 21 696 9.0E-142
sp|A6ZPJ1|EIF3B_YEAS7 Eukaryotic translation initiation factor 3 subunit B OS=Saccharomyces cerevisiae (strain YJM789) GN=PRT1 PE=3 SV=1 21 696 7.0E-141
sp|Q6FM92|EIF3B_CANGA Eukaryotic translation initiation factor 3 subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRT1 PE=3 SV=1 21 687 1.0E-137
sp|Q9C5Z1|EIF3B_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana GN=TIF3B1 PE=1 SV=1 35 741 2.0E-136
sp|Q1HDZ5|EIF3B_BOMMO Eukaryotic translation initiation factor 3 subunit B OS=Bombyx mori GN=eIF3-S9 PE=2 SV=1 10 745 2.0E-133
sp|B4LM71|EIF3B_DROVI Eukaryotic translation initiation factor 3 subunit B OS=Drosophila virilis GN=eIF3-S9 PE=3 SV=1 6 745 1.0E-125
sp|B0W562|EIF3B_CULQU Eukaryotic translation initiation factor 3 subunit B OS=Culex quinquefasciatus GN=eIF3-S9 PE=3 SV=1 39 745 9.0E-125
sp|B3ME25|EIF3B_DROAN Eukaryotic translation initiation factor 3 subunit B OS=Drosophila ananassae GN=eIF3-S9 PE=3 SV=1 11 745 1.0E-124
sp|B4P5F7|EIF3B_DROYA Eukaryotic translation initiation factor 3 subunit B OS=Drosophila yakuba GN=eIF3-S9 PE=3 SV=1 39 745 2.0E-124
sp|B4KNN9|EIF3B_DROMO Eukaryotic translation initiation factor 3 subunit B OS=Drosophila mojavensis GN=eIF3-S9 PE=3 SV=1 6 745 3.0E-124
sp|Q0IEY3|EIF3B_AEDAE Eukaryotic translation initiation factor 3 subunit B OS=Aedes aegypti GN=eIF3-S9 PE=3 SV=1 6 745 2.0E-123
sp|Q0E940|EIF3B_DROME Eukaryotic translation initiation factor 3 subunit B OS=Drosophila melanogaster GN=eIF3-S9 PE=1 SV=1 6 745 2.0E-123
sp|B4QB88|EIF3B_DROSI Eukaryotic translation initiation factor 3 subunit B OS=Drosophila simulans GN=eIF3-S9 PE=3 SV=1 39 745 4.0E-123
sp|B4HMV9|EIF3B_DROSE Eukaryotic translation initiation factor 3 subunit B OS=Drosophila sechellia GN=eIF3-S9 PE=3 SV=1 39 745 4.0E-123
sp|B3NMI5|EIF3B_DROER Eukaryotic translation initiation factor 3 subunit B OS=Drosophila erecta GN=eIF3-S9 PE=3 SV=1 39 745 7.0E-123
sp|B4MQL8|EIF3B_DROWI Eukaryotic translation initiation factor 3 subunit B OS=Drosophila willistoni GN=eIF3-S9 PE=3 SV=1 6 745 8.0E-122
sp|B4J6D5|EIF3B_DROGR Eukaryotic translation initiation factor 3 subunit B OS=Drosophila grimshawi GN=eIF3-S9 PE=3 SV=1 6 745 2.0E-121
sp|B5E081|EIF3B_DROPS Eukaryotic translation initiation factor 3 subunit B OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S9 PE=3 SV=1 39 699 3.0E-120
sp|B4GAY7|EIF3B_DROPE Eukaryotic translation initiation factor 3 subunit B OS=Drosophila persimilis GN=eIF3-S9 PE=3 SV=1 39 699 3.0E-120
sp|Q7PZY1|EIF3B_ANOGA Eukaryotic translation initiation factor 3 subunit B OS=Anopheles gambiae GN=eIF3-S9 PE=3 SV=3 6 745 9.0E-117
sp|Q54QW1|EIF3B_DICDI Eukaryotic translation initiation factor 3 subunit B OS=Dictyostelium discoideum GN=eif3B PE=3 SV=2 18 702 3.0E-113
sp|Q9XWI6|EIF3B_CAEEL Eukaryotic translation initiation factor 3 subunit B OS=Caenorhabditis elegans GN=eif-3.B PE=3 SV=2 41 713 7.0E-76
sp|A8WX15|EIF3B_CAEBR Eukaryotic translation initiation factor 3 subunit B OS=Caenorhabditis briggsae GN=eif-3.B PE=3 SV=3 40 698 2.0E-74
sp|P12806|EIF3B_PICAN Eukaryotic translation initiation factor 3 subunit B (Fragment) OS=Pichia angusta GN=TIF32 PE=3 SV=1 13 226 4.0E-42
sp|Q54PV7|EIF2A_DICDI Eukaryotic translation initiation factor 2A OS=Dictyostelium discoideum GN=eif2a PE=3 SV=1 204 641 3.0E-16
sp|O74965|EIF2A_SCHPO Eukaryotic translation initiation factor 2A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4B4.04 PE=1 SV=1 243 638 7.0E-12
sp|P53235|EIF2A_YEAST Eukaryotic translation initiation factor 2A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR054W PE=1 SV=1 376 631 3.0E-09
sp|Q19052|EIF2A_CAEEL Eukaryotic translation initiation factor 2A OS=Caenorhabditis elegans GN=E04D5.1 PE=3 SV=2 316 632 2.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3868
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2608
Ophiocordyceps australis map64 (Brazil) OphauB2|6814
Ophiocordyceps camponoti-floridani Ophcf2|05407
Ophiocordyceps camponoti-rufipedis Ophun1|5995 (this protein)
Ophiocordyceps kimflemingae Ophio5|1580
Ophiocordyceps subramaniannii Hirsu2|7657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5995
MAPSFDHLREADLDDDEFNEDDIDISDLRERFEVQLEQGFDTFVVIDGLPQVTEDQKPKLIKFMMRKLNTVGKAR
EDSIYMPMGEDGKSLQFAFVEYSRPSEAAQAVRQLDRVPLDKKHTLRVNKVTDIERYGGEGRVDDEYHAPHIDEF
VEKEHLRWWLRDPSERGRDQFVMFRGDTVGVYWNNERDQPENIVDRQHWTETFLQWSPLGTYLTSMHPQGVQLWG
GSSWSRQARFAHPYVDLVAFSPNEKYLVTWSRREISIPDGGHPALSVDDDGKNYVIWDIPTATPLRSFANLELPK
TEEGKPPAKMQWPAFKWSADEKYVARLAQGSSISVYELPKMSLLDKSTIKIEGVMDFDWAPAVPSREGVKSYEQL
FCFWTPEIGSNPAKVGLMSIPSKQIVRTLNLFSVSDAKLHWQSDAAYLCVKVDRHSKSKKSQATTLEIFRIKEKG
VPVEVVDTIKDTVINFAWEPRGDRFAIITTTEPVGATAVPPKTAVSFFCPEKNKGPVAGNFKLLRTLEKKNSNAI
YWSPRGRFVVIAAIHNQQSSDLDFFDLDFEGEKPESDKDLTANLQLMNTADHYGVTDVEWDPSGRFVATWASFWK
HSMENGYHLYDFKGEALREEPMEKFKQFQWRPRPPTLLTKEEQKQVRKNLREYSRVFEQEDADRGASADLAVVEA
RRRTLEEWHAWRDDVEAELEEERSALGLPGDPQAALLEAKTQEMQGAGAEQEQVIEEIVEDVLEESEEILG*
Coding >Ophun1|5995
ATGGCTCCCTCATTCGACCATCTGCGCGAGGCAGACCTCGACGATGACGAGTTCAACGAGGATGACATCGACATT
TCCGATCTGCGAGAGAGGTTTGAAGTTCAGCTGGAGCAAGGTTTCGACACTTTTGTCGTCATCGACGGACTGCCT
CAGGTCACCGAGGACCAAAAGCCCAAGTTGATCAAGTTTATGATGAGGAAGCTTAATACCGTCGGCAAGGCTCGT
GAGGATTCCATATATATGCCGATGGGTGAGGATGGAAAATCTTTGCAATTCGCCTTTGTCGAATACTCGCGCCCT
TCTGAAGCTGCTCAAGCTGTCCGACAGCTCGACAGGGTCCCCCTTGACAAGAAGCACACTCTGCGAGTGAACAAG
GTGACCGATATTGAACGATATGGTGGTGAAGGTCGCGTCGACGACGAATATCATGCACCTCATATCGACGAATTC
GTCGAGAAGGAACATTTGCGATGGTGGCTCAGAGATCCTTCGGAGCGCGGTCGCGACCAATTCGTCATGTTCCGC
GGAGACACCGTCGGCGTCTACTGGAATAACGAGCGCGACCAGCCCGAGAACATCGTTGATCGTCAGCACTGGACC
GAGACTTTTCTTCAGTGGTCGCCTCTGGGTACCTACCTCACGTCGATGCACCCACAGGGCGTTCAGCTCTGGGGC
GGCTCCTCGTGGTCCAGACAAGCCCGTTTTGCGCATCCCTACGTCGACCTGGTGGCCTTTTCGCCAAACGAAAAA
TACCTCGTCACCTGGTCTCGCCGTGAGATATCCATCCCGGACGGCGGCCACCCCGCCCTGTCGGTCGACGACGAC
GGAAAAAACTACGTCATCTGGGATATCCCCACGGCCACGCCGCTCCGATCTTTCGCCAACCTGGAGCTCCCAAAG
ACGGAGGAGGGCAAGCCGCCTGCCAAGATGCAATGGCCGGCGTTCAAGTGGTCGGCCGACGAGAAATACGTAGCC
CGGCTGGCGCAGGGATCTTCGATCTCGGTCTACGAGCTGCCGAAGATGTCCCTCTTGGACAAGTCGACCATCAAG
ATCGAGGGCGTCATGGACTTTGACTGGGCGCCGGCGGTACCTTCGCGGGAAGGCGTCAAGAGCTACGAACAGCTA
TTTTGCTTCTGGACGCCCGAGATCGGGAGCAACCCGGCCAAGGTCGGACTGATGAGCATCCCGTCCAAGCAGATT
GTGAGGACGCTCAACCTCTTCAGCGTCAGCGACGCCAAGCTCCACTGGCAGTCGGATGCCGCCTATCTCTGCGTC
AAGGTCGACCGGCACTCGAAATCCAAGAAGTCGCAGGCCACGACGCTCGAGATCTTCCGCATCAAGGAGAAGGGC
GTGCCCGTCGAGGTGGTGGATACGATCAAGGACACCGTCATCAACTTTGCCTGGGAGCCCCGTGGCGATCGGTTC
GCCATCATCACGACGACGGAGCCCGTCGGCGCCACAGCCGTCCCTCCCAAGACGGCCGTCTCCTTCTTCTGCCCG
GAGAAGAACAAGGGCCCAGTGGCAGGTAACTTTAAGCTCCTCCGCACGCTGGAGAAGAAGAACAGCAATGCGATA
TACTGGTCTCCCCGGGGCCGGTTTGTCGTCATCGCCGCCATTCACAATCAGCAGAGCTCGGATCTCGACTTCTTC
GACCTCGACTTTGAGGGCGAGAAGCCCGAGTCGGACAAGGACCTGACGGCCAACCTCCAGTTGATGAATACTGCT
GATCATTATGGCGTGACGGATGTGGAATGGGATCCTTCGGGACGTTTCGTGGCCACTTGGGCATCGTTCTGGAAG
CATTCGATGGAGAATGGCTATCATCTCTACGATTTTAAGGGGGAGGCGCTGCGGGAGGAGCCGATGGAGAAGTTC
AAGCAGTTCCAGTGGCGTCCACGCCCACCCACGCTGCTGACCAAGGAAGAGCAGAAGCAGGTACGCAAGAACCTG
CGAGAGTACAGCCGTGTGTTTGAGCAGGAAGACGCCGATCGGGGCGCGTCGGCGGACCTGGCAGTGGTGGAAGCG
CGTCGGCGCACGCTCGAAGAATGGCACGCCTGGCGGGACGACGTCGAGGCCGAACTGGAGGAGGAGCGGTCAGCC
CTCGGACTGCCCGGCGATCCCCAGGCGGCCCTTTTGGAGGCCAAGACCCAGGAAATGCAAGGCGCCGGGGCGGAG
CAGGAGCAGGTGATTGAGGAGATTGTCGAGGACGTGTTGGAGGAGAGCGAGGAGATCTTGGGCTGA
Transcript >Ophun1|5995
ATGGCTCCCTCATTCGACCATCTGCGCGAGGCAGACCTCGACGATGACGAGTTCAACGAGGATGACATCGACATT
TCCGATCTGCGAGAGAGGTTTGAAGTTCAGCTGGAGCAAGGTTTCGACACTTTTGTCGTCATCGACGGACTGCCT
CAGGTCACCGAGGACCAAAAGCCCAAGTTGATCAAGTTTATGATGAGGAAGCTTAATACCGTCGGCAAGGCTCGT
GAGGATTCCATATATATGCCGATGGGTGAGGATGGAAAATCTTTGCAATTCGCCTTTGTCGAATACTCGCGCCCT
TCTGAAGCTGCTCAAGCTGTCCGACAGCTCGACAGGGTCCCCCTTGACAAGAAGCACACTCTGCGAGTGAACAAG
GTGACCGATATTGAACGATATGGTGGTGAAGGTCGCGTCGACGACGAATATCATGCACCTCATATCGACGAATTC
GTCGAGAAGGAACATTTGCGATGGTGGCTCAGAGATCCTTCGGAGCGCGGTCGCGACCAATTCGTCATGTTCCGC
GGAGACACCGTCGGCGTCTACTGGAATAACGAGCGCGACCAGCCCGAGAACATCGTTGATCGTCAGCACTGGACC
GAGACTTTTCTTCAGTGGTCGCCTCTGGGTACCTACCTCACGTCGATGCACCCACAGGGCGTTCAGCTCTGGGGC
GGCTCCTCGTGGTCCAGACAAGCCCGTTTTGCGCATCCCTACGTCGACCTGGTGGCCTTTTCGCCAAACGAAAAA
TACCTCGTCACCTGGTCTCGCCGTGAGATATCCATCCCGGACGGCGGCCACCCCGCCCTGTCGGTCGACGACGAC
GGAAAAAACTACGTCATCTGGGATATCCCCACGGCCACGCCGCTCCGATCTTTCGCCAACCTGGAGCTCCCAAAG
ACGGAGGAGGGCAAGCCGCCTGCCAAGATGCAATGGCCGGCGTTCAAGTGGTCGGCCGACGAGAAATACGTAGCC
CGGCTGGCGCAGGGATCTTCGATCTCGGTCTACGAGCTGCCGAAGATGTCCCTCTTGGACAAGTCGACCATCAAG
ATCGAGGGCGTCATGGACTTTGACTGGGCGCCGGCGGTACCTTCGCGGGAAGGCGTCAAGAGCTACGAACAGCTA
TTTTGCTTCTGGACGCCCGAGATCGGGAGCAACCCGGCCAAGGTCGGACTGATGAGCATCCCGTCCAAGCAGATT
GTGAGGACGCTCAACCTCTTCAGCGTCAGCGACGCCAAGCTCCACTGGCAGTCGGATGCCGCCTATCTCTGCGTC
AAGGTCGACCGGCACTCGAAATCCAAGAAGTCGCAGGCCACGACGCTCGAGATCTTCCGCATCAAGGAGAAGGGC
GTGCCCGTCGAGGTGGTGGATACGATCAAGGACACCGTCATCAACTTTGCCTGGGAGCCCCGTGGCGATCGGTTC
GCCATCATCACGACGACGGAGCCCGTCGGCGCCACAGCCGTCCCTCCCAAGACGGCCGTCTCCTTCTTCTGCCCG
GAGAAGAACAAGGGCCCAGTGGCAGGTAACTTTAAGCTCCTCCGCACGCTGGAGAAGAAGAACAGCAATGCGATA
TACTGGTCTCCCCGGGGCCGGTTTGTCGTCATCGCCGCCATTCACAATCAGCAGAGCTCGGATCTCGACTTCTTC
GACCTCGACTTTGAGGGCGAGAAGCCCGAGTCGGACAAGGACCTGACGGCCAACCTCCAGTTGATGAATACTGCT
GATCATTATGGCGTGACGGATGTGGAATGGGATCCTTCGGGACGTTTCGTGGCCACTTGGGCATCGTTCTGGAAG
CATTCGATGGAGAATGGCTATCATCTCTACGATTTTAAGGGGGAGGCGCTGCGGGAGGAGCCGATGGAGAAGTTC
AAGCAGTTCCAGTGGCGTCCACGCCCACCCACGCTGCTGACCAAGGAAGAGCAGAAGCAGGTACGCAAGAACCTG
CGAGAGTACAGCCGTGTGTTTGAGCAGGAAGACGCCGATCGGGGCGCGTCGGCGGACCTGGCAGTGGTGGAAGCG
CGTCGGCGCACGCTCGAAGAATGGCACGCCTGGCGGGACGACGTCGAGGCCGAACTGGAGGAGGAGCGGTCAGCC
CTCGGACTGCCCGGCGATCCCCAGGCGGCCCTTTTGGAGGCCAAGACCCAGGAAATGCAAGGCGCCGGGGCGGAG
CAGGAGCAGGTGATTGAGGAGATTGTCGAGGACGTGTTGGAGGAGAGCGAGGAGATCTTGGGCTGA
Gene >Ophun1|5995
ATGGCTCCCTCATTCGACCATCTGCGCGAGGCAGACCTCGACGATGACGAGTTCAACGAGGATGACATCGACATT
TCCGATCTGCGAGAGAGGTTTGAAGTTCAGCTGGAGCAAGGTTTCGACACTTTTGTCGTCATCGACGGACTGCCT
CAGGTCACCGAGGACCAAAAGCCCAAGTTGATCAAGTTTATGATGAGGAAGCTTAATACCGTCGGCAAGGCTCGT
GAGGATTCCATATATATGCCGATGGGTGAGGATGGAAAATCTTTGCAGTCAGTTGCCTCATCCCCCCCACAGACG
TGCTCGGCCGCTAATGTGGACCACAGATTCGCCTTTGTCGAATACTCGCGCCCTTCTGAAGCTGCTCAAGCTGTC
CGACAGCTCGACAGGGTCCCCCTTGACAAGAAGCACACTCTGCGAGTGAACAAGGTGACCGATATTGAACGATAT
GGTGGTGAAGGTCGCGTCGACGACGAATATCATGCACCTCATATCGACGAATTCGTCGAGAAGGAACATTTGCGA
TGGTGGCTCAGAGATCCTTCGGAGCGCGGTCGCGACCAATTCGTCATGTTCCGCGGAGACACCGTCGGCGTCTAC
TGGAATAACGAGCGCGACCAGCCCGAGAACATCGTTGATCGTCAGCACTGGACCGAGACTTTTCTTCAGTGGTCG
CCTCTGGGTACCTACCTCACGTCGATGCACCCACAGGGCGTTCAGCTCTGGGGCGGCTCCTCGTGGTCCAGACAA
GCCCGTTTTGCGCATCCCTACGTCGACCTGGTGGCCTTTTCGCCAAACGAAAAATACCTCGTCACCTGGTCTCGC
CGTGAGATATCCATCCCGGACGGCGGCCACCCCGCCCTGTCGGTCGACGACGACGGAAAAAACTACGTCATCTGG
GATATCCCCACGGCCACGCCGCTCCGATCTTTCGCCAACCTGGAGCTCCCAAAGACGGAGGAGGGCAAGCCGCCT
GCCAAGATGCAATGGCCGGCGTTCAAGTGGTCGGCCGACGAGAAATACGTAGCCCGGCTGGCGCAGGGATCTTCG
ATCTCGGTCTACGAGCTGCCGAAGATGTCCCTCTTGGACAAGTCGACCATCAAGATCGAGGGCGTCATGGACTTT
GACTGGGCGCCGGCGGTACCTTCGCGGGAAGGCGTCAAGAGCTACGAACAGCTATTTTGCTTCTGGACGCCCGAG
ATCGGGAGCAACCCGGCCAAGGTCGGACTGATGAGCATCCCGTCCAAGCAGATTGTGAGGACGCTCAACCTCTTC
AGCGTCAGCGACGCCAAGCTCCACTGGCAGTCGGATGCCGCCTATCTCTGCGTCAAGGTCGACCGGCACTCGAAA
TCCAAGAAGTCGCAGGCCACGACGCTCGAGATCTTCCGCATCAAGGAGAAGGGCGTGCCCGTCGAGGTGGTGGAT
ACGATCAAGGACACCGTCATCAACTTTGCCTGGGAGCCCCGTGGCGATCGGTTCGCCATCATCACGACGACGGAG
CCCGTCGGCGCCACAGCCGTCCCTCCCAAGACGGCCGTCTCCTTCTTCTGCCCGGAGAAGAACAAGGGCCCAGTG
GCAGGTAACTTTAAGCTCCTCCGCACGCTGGAGAAGAAGAACAGCAATGCGATATACTGGTCTCCCCGGGGCCGG
TTTGTCGTCATCGCCGCCATTCACAATCAGCAGAGCTCGGATCTCGACTTCTTCGACCTCGACTTTGAGGGCGAG
AAGCCCGAGTCGGACAAGGACCTGACGGCCAACCTCCAGTTGATGAATACTGCTGATCATTATGGCGTGACGGAT
GTGGAATGGGATCCTTCGGGACGTTTCGTGGCCACTTGGGCATCGTTCTGGAAGCATTCGGTAAGCTCTTTTTTA
GAGAGCGAAGAGGACAGAGTGAAAGAGACTGACAAGGAGACGCAGATGGAGAATGGCTATCATCTCTACGATTTT
AAGGGGGAGGCGCTGCGGGAGGAGCCGATGGAGAAGTTCAAGCAGTTCCAGTGGCGTCCACGCCCACCCACGCTG
CTGACCAAGGAAGAGCAGAAGCAGGTACGCAAGAACCTGCGAGAGTACAGCCGTGTGTTTGAGCAGGAAGACGCC
GATCGGGGCGCGTCGGCGGACCTGGCAGTGGTGGAAGCGCGTCGGCGCACGCTCGAAGAATGGCACGCCTGGCGG
GACGACGTCGAGGCCGAACTGGAGGAGGAGCGGTCAGCCCTCGGACTGCCCGGCGATCCCCAGGCGGCCCTTTTG
GAGGCCAAGACCCAGGAAATGCAAGGCGCCGGGGCGGAGCAGGAGCAGGTGATTGAGGAGATTGTCGAGGACGTG
TTGGAGGAGAGCGAGGAGATCTTGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail