Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5994
Gene name
LocationContig_621:9246..9939
Strand+
Gene length (bp)693
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04148 Erv26 Transmembrane adaptor Erv26 6.6E-89 1 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38869|SVP26_YEAST Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVP26 PE=1 SV=1 3 201 1.0E-51
sp|Q1MTR8|SVP26_SCHPO Protein svp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svp26 PE=3 SV=1 1 171 4.0E-39
sp|Q6UWH6|TX261_HUMAN Protein TEX261 OS=Homo sapiens GN=TEX261 PE=2 SV=1 1 198 3.0E-31
sp|Q5BJW3|TX261_RAT Protein TEX261 OS=Rattus norvegicus GN=Tex261 PE=2 SV=1 1 198 9.0E-31
sp|Q62302|TX261_MOUSE Protein TEX261 OS=Mus musculus GN=Tex261 PE=2 SV=1 1 198 9.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38869|SVP26_YEAST Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVP26 PE=1 SV=1 3 201 1.0E-51
sp|Q1MTR8|SVP26_SCHPO Protein svp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svp26 PE=3 SV=1 1 171 4.0E-39
sp|Q6UWH6|TX261_HUMAN Protein TEX261 OS=Homo sapiens GN=TEX261 PE=2 SV=1 1 198 3.0E-31
sp|Q5BJW3|TX261_RAT Protein TEX261 OS=Rattus norvegicus GN=Tex261 PE=2 SV=1 1 198 9.0E-31
sp|Q62302|TX261_MOUSE Protein TEX261 OS=Mus musculus GN=Tex261 PE=2 SV=1 1 198 9.0E-31
sp|Q5RFE0|TX261_PONAB Protein TEX261 OS=Pongo abelii GN=TEX261 PE=2 SV=1 1 198 5.0E-30
sp|Q58DA4|TX261_BOVIN Protein TEX261 OS=Bos taurus GN=TEX261 PE=2 SV=1 24 168 2.0E-27
sp|Q54ER8|TX261_DICDI Protein TEX261 homolog OS=Dictyostelium discoideum GN=DDB_G0291374 PE=3 SV=1 3 209 1.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0097020 COPII receptor activity Yes
GO:0048193 Golgi vesicle transport No
GO:0008150 biological_process No
GO:0038024 cargo receptor activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0016192 vesicle-mediated transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 31 21
2 44 61 17
3 65 82 17
4 89 111 22
5 137 159 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5994
MWILPLVGYAGTIVGFCFLTLAIASGLYYLSELVEEHTVIAKRLLTRLIYSIVGLQIVLWLVDGFPFWATVLGIF
AHVVYLANLRRFPFVQVTSPVFALAVVLVFLDHWVWFRHFSHGQTRAHQRSSYYDDVDAPTFTMIASYFGLCVWL
VPFALFVSLSAADNVLPTMGSEPVRGADGKSKHQGMVKAVVDRVRGAIGDLVGSWNMDRP*
Coding >Ophun1|5994
ATGTGGATCCTGCCGCTTGTCGGTTACGCCGGCACCATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCCATCGTTGGTTTGCAGATTGTACTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACTGTGTTGGGCATCTTT
GCCCATGTCGTCTATCTTGCCAATTTGAGACGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGCTGGCG
GTCGTTCTTGTCTTCTTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAAACGCGTGCCCATCAACGG
TCTTCGTACTATGACGACGTCGACGCCCCTACCTTTACCATGATTGCCTCTTACTTCGGTCTGTGTGTCTGGCTT
GTCCCTTTTGCCCTCTTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGT
GGCGCCGACGGCAAGAGCAAGCATCAGGGCATGGTCAAGGCTGTGGTCGACCGTGTTCGCGGCGCCATCGGGGAC
CTTGTCGGCTCGTGGAATATGGATCGGCCTTAG
Transcript >Ophun1|5994
ATGTGGATCCTGCCGCTTGTCGGTTACGCCGGCACCATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCCATCGTTGGTTTGCAGATTGTACTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACTGTGTTGGGCATCTTT
GCCCATGTCGTCTATCTTGCCAATTTGAGACGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGCTGGCG
GTCGTTCTTGTCTTCTTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAAACGCGTGCCCATCAACGG
TCTTCGTACTATGACGACGTCGACGCCCCTACCTTTACCATGATTGCCTCTTACTTCGGTCTGTGTGTCTGGCTT
GTCCCTTTTGCCCTCTTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGT
GGCGCCGACGGCAAGAGCAAGCATCAGGGCATGGTCAAGGCTGTGGTCGACCGTGTTCGCGGCGCCATCGGGGAC
CTTGTCGGCTCGTGGAATATGGATCGGCCTTAG
Gene >Ophun1|5994
ATGTGGATCCTGCCGCTTGTCGGTTACGCCGGCACCATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCCATCGTTGGTTTGCAGATTGTACTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACTGTGTTGGGCATCTTT
GCCCATGTCGTCTATCTTGCCAATTTGAGACGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGCTGGCG
GTCGGTATGTCTGGAGTCTCGCTCAACCATTCTCTTCTGATGCTAACGACGATGGTCTCTGCAGTTCTTGTCTTC
TTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAAACGCGTGCCCATCAACGGTCTTCGTACTATGAC
GACGTCGACGCCCCTACCTTTACCATGATTGCCTCTTACTTCGGTCTGTGTGTCTGGCTTGTCCCTTTTGCCCTC
TTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGTGGCGCCGACGGCAAG
AGCAAGCATCAGGGCATGGTCAAGGCTGTGGTCGACCGTGTTCGCGGCGCCATCGGGGACCTTGTCGGCTCGTGG
AATATGGATCGGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail