Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5990
Gene name
LocationContig_621:878..1991
Strand-
Gene length (bp)1113
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 3.1E-80 19 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13302|IDH1_AJECA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 1 352 0.0E+00
sp|O13696|IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 5 352 9.0E-176
sp|O94229|IDH1_KLULA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 1 350 6.0E-164
sp|P28834|IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 5 350 6.0E-154
sp|Q54B68|IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum GN=idhB PE=3 SV=1 17 353 2.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13302|IDH1_AJECA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 1 352 0.0E+00
sp|O13696|IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 5 352 9.0E-176
sp|O94229|IDH1_KLULA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 1 350 6.0E-164
sp|P28834|IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 5 350 6.0E-154
sp|Q54B68|IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum GN=idhB PE=3 SV=1 17 353 2.0E-120
sp|Q945K7|IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana GN=IDH5 PE=2 SV=1 19 350 9.0E-115
sp|P41564|IDH3G_MACFA Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3G PE=2 SV=1 5 347 2.0E-113
sp|Q58CP0|IDH3G_BOVIN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Bos taurus GN=IDH3G PE=2 SV=1 5 347 4.0E-113
sp|Q28479|IDH3B_MACFA Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Macaca fascicularis GN=IDH3B PE=2 SV=2 16 347 1.0E-112
sp|O77784|IDH3B_BOVIN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Bos taurus GN=IDH3B PE=2 SV=2 16 347 2.0E-112
sp|P70404|IDHG1_MOUSE Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus GN=Idh3g PE=1 SV=1 5 347 3.0E-112
sp|P41565|IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus GN=Idh3g PE=1 SV=2 5 347 4.0E-112
sp|P51553|IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens GN=IDH3G PE=1 SV=1 12 347 7.0E-112
sp|O43837|IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens GN=IDH3B PE=1 SV=2 16 351 2.0E-111
sp|Q93353|IDH3B_CAEEL Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=idhb-1 PE=3 SV=1 11 350 5.0E-111
sp|Q8LFC0|IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana GN=IDH1 PE=2 SV=2 15 351 1.0E-110
sp|Q68FX0|IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus GN=Idh3B PE=2 SV=1 16 347 2.0E-110
sp|Q5RBT4|IDH3B_PONAB Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Pongo abelii GN=IDH3B PE=2 SV=1 16 347 2.0E-109
sp|Q55BI2|IDHA_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit A, mitochondrial OS=Dictyostelium discoideum GN=idhA PE=3 SV=1 20 350 8.0E-109
sp|P93032|IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana GN=IDH2 PE=2 SV=2 15 351 1.0E-108
sp|Q8LG77|IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana GN=IDH6 PE=2 SV=2 21 350 5.0E-107
sp|O81796|IDH3_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial OS=Arabidopsis thaliana GN=IDH3 PE=1 SV=1 15 351 7.0E-107
sp|Q4QQT5|IDHG2_RAT Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Rattus norvegicus PE=2 SV=1 13 351 1.0E-106
sp|Q8BPC6|IDHG2_MOUSE Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus PE=2 SV=1 13 351 4.0E-104
sp|P41563|IDH3A_BOVIN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Bos taurus GN=IDH3A PE=1 SV=1 15 351 2.0E-103
sp|P50213|IDH3A_HUMAN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens GN=IDH3A PE=1 SV=1 15 351 3.0E-103
sp|Q28480|IDH3A_MACFA Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3A PE=2 SV=2 15 351 3.0E-103
sp|Q5R678|IDH3A_PONAB Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Pongo abelii GN=IDH3A PE=2 SV=1 15 351 4.0E-103
sp|Q9D6R2|IDH3A_MOUSE Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus GN=Idh3a PE=1 SV=1 15 351 5.0E-103
sp|Q99NA5|IDH3A_RAT Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Idh3a PE=1 SV=1 15 351 4.0E-102
sp|Q9VWH4|IDH3A_DROME Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=l(1)G0156 PE=2 SV=1 16 350 8.0E-102
sp|P29696|LEU3_SOLTU 3-isopropylmalate dehydrogenase, chloroplastic OS=Solanum tuberosum PE=2 SV=1 21 328 1.0E-99
sp|Q9USP8|IDH2_SCHPO Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh2 PE=1 SV=2 16 351 7.0E-99
sp|Q93714|IDH3A_CAEEL Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=idha-1 PE=3 SV=3 6 351 2.0E-97
sp|O94230|IDH2_KLULA Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH2 PE=3 SV=1 10 350 2.0E-95
sp|P28241|IDH2_YEAST Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH2 PE=1 SV=1 10 350 2.0E-95
sp|P33197|IDH_THET8 Isocitrate dehydrogenase [NADP] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=icd PE=1 SV=2 16 350 2.0E-73
sp|O29627|LEU3_ARCFU 3-isopropylmalate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuB PE=3 SV=1 20 346 2.0E-67
sp|P50455|LEU3_SULTO 3-isopropylmalate dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuB PE=1 SV=3 18 350 2.0E-67
sp|O27441|LEU3_METTH 3-isopropylmalate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuB PE=3 SV=1 20 351 6.0E-66
sp|Q5SIJ1|HICDH_THET8 Homoisocitrate dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hicd PE=1 SV=1 18 352 1.0E-63
sp|Q72IW9|HICDH_THET2 Homoisocitrate dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hicd PE=1 SV=1 18 352 1.0E-63
sp|Q58130|LEU3_METJA 3-isopropylmalate/3-methylmalate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuB PE=1 SV=2 18 346 3.0E-60
sp|Q1RJU4|IDH_RICBR Isocitrate dehydrogenase [NADP] OS=Rickettsia bellii (strain RML369-C) GN=icd PE=3 SV=1 20 350 2.0E-54
sp|Q4UKR1|IDH_RICFE Isocitrate dehydrogenase [NADP] OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=icd PE=3 SV=2 20 350 2.0E-54
sp|Q9ZDR0|IDH_RICPR Isocitrate dehydrogenase [NADP] OS=Rickettsia prowazekii (strain Madrid E) GN=icd PE=3 SV=1 20 350 1.0E-53
sp|Q92IR7|IDH_RICCN Isocitrate dehydrogenase [NADP] OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=icd PE=3 SV=1 20 350 4.0E-53
sp|Q68XA5|IDH_RICTY Isocitrate dehydrogenase [NADP] OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=icd PE=3 SV=1 20 350 5.0E-53
sp|Q58991|AKSF_METJA Homoisocitrate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aksF PE=1 SV=3 20 348 5.0E-52
sp|Q9UXB2|LEU3_SULSO 3-isopropylmalate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuB PE=3 SV=1 18 350 1.0E-51
sp|P40495|LYS12_YEAST Homoisocitrate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS12 PE=1 SV=1 19 350 3.0E-51
sp|O14104|LYS12_SCHPO Homoisocitrate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys12 PE=1 SV=1 22 347 3.0E-51
sp|O29610|IDH_ARCFU Isocitrate dehydrogenase [NADP] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=icd PE=1 SV=1 20 352 7.0E-51
sp|D4GYE8|LEU3_HALVD 3-isopropylmalate dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuB PE=3 SV=1 20 350 3.0E-47
sp|Q59985|IDH_STRSL Isocitrate dehydrogenase [NADP] OS=Streptococcus salivarius GN=icd PE=3 SV=1 20 350 2.0E-46
sp|O59394|HICD_PYRHO Isocitrate--homoisocitrate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1722 PE=1 SV=2 18 353 2.0E-45
sp|Q59940|IDH_STRMU Isocitrate dehydrogenase [NADP] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=icd PE=3 SV=2 17 347 8.0E-45
sp|Q48806|DLPA_LEGPH Protein DlpA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dlpA PE=3 SV=1 20 348 9.0E-45
sp|D4GU92|IDH_HALVD Isocitrate dehydrogenase [NADP] OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=icd PE=1 SV=1 20 351 3.0E-43
sp|Q9LQK9|IDH4_ARATH Putative isocitrate dehydrogenase [NAD] subunit-like 4 OS=Arabidopsis thaliana GN=IDH4 PE=5 SV=1 24 351 8.0E-42
sp|Q02NB5|IDH_PSEAB Isocitrate dehydrogenase [NADP] OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=icd PE=1 SV=1 20 350 5.0E-40
sp|P96318|IDH_CALNO Isocitrate dehydrogenase [NADP] OS=Caldococcus noboribetus GN=icd PE=1 SV=2 20 348 8.0E-40
sp|O86504|LEU3_STRCO 3-isopropylmalate dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuB PE=3 SV=1 20 325 1.0E-39
sp|Q8CNX4|IDH_STAES Isocitrate dehydrogenase [NADP] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=icd PE=3 SV=1 20 333 2.0E-39
sp|Q5HNL1|IDH_STAEQ Isocitrate dehydrogenase [NADP] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=icd PE=3 SV=1 20 333 2.0E-39
sp|Q6GG12|IDH_STAAR Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MRSA252) GN=icd PE=3 SV=1 20 333 4.0E-39
sp|P99167|IDH_STAAN Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain N315) GN=icd PE=1 SV=1 20 333 4.0E-39
sp|P65099|IDH_STAAM Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=icd PE=3 SV=1 20 333 4.0E-39
sp|Q5HF79|IDH_STAAC Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain COL) GN=icd PE=3 SV=1 20 333 4.0E-39
sp|P24098|LEU3_THEAQ 3-isopropylmalate dehydrogenase OS=Thermus aquaticus GN=leuB PE=3 SV=1 20 350 4.0E-39
sp|Q8NW61|IDH_STAAW Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MW2) GN=icd PE=3 SV=1 20 333 6.0E-39
sp|Q6G8N2|IDH_STAAS Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MSSA476) GN=icd PE=3 SV=1 20 333 6.0E-39
sp|P05645|LEU3_BACSU 3-isopropylmalate dehydrogenase OS=Bacillus subtilis (strain 168) GN=leuB PE=3 SV=3 17 352 1.0E-38
sp|P41560|IDH1_COLMA Isocitrate dehydrogenase [NADP] 1 OS=Colwellia maris GN=icdI PE=1 SV=2 20 308 1.0E-38
sp|Q02143|LEU3_LACLA 3-isopropylmalate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuB PE=3 SV=3 17 347 2.0E-38
sp|Q9ZH99|IDH_COXBU Isocitrate dehydrogenase [NADP] OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=icd PE=1 SV=1 20 347 4.0E-38
sp|B1VZ57|LEU3_STRGG 3-isopropylmalate dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuB PE=3 SV=1 20 346 4.0E-38
sp|C4LJH3|LEU3_CORK4 3-isopropylmalate dehydrogenase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=leuB PE=3 SV=1 20 334 6.0E-38
sp|Q65GI9|LEU3_BACLD 3-isopropylmalate dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuB PE=3 SV=2 17 352 7.0E-38
sp|C5C2I9|LEU3_BEUC1 3-isopropylmalate dehydrogenase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=leuB PE=3 SV=1 20 325 9.0E-38
sp|Q1IZK2|LEU3_DEIGD 3-isopropylmalate dehydrogenase OS=Deinococcus geothermalis (strain DSM 11300) GN=leuB PE=3 SV=1 20 350 1.0E-37
sp|P08200|IDH_ECOLI Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) GN=icd PE=1 SV=1 20 350 1.0E-37
sp|P61495|LEU3_THETH 3-isopropylmalate dehydrogenase OS=Thermus thermophilus GN=leuB PE=1 SV=2 20 347 2.0E-37
sp|P56063|IDH_HELPY Isocitrate dehydrogenase [NADP] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=icd PE=3 SV=1 20 350 3.0E-37
sp|Q9ZN36|IDH_HELPJ Isocitrate dehydrogenase [NADP] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=icd PE=3 SV=1 20 350 3.0E-37
sp|P39126|IDH_BACSU Isocitrate dehydrogenase [NADP] OS=Bacillus subtilis (strain 168) GN=icd PE=1 SV=1 20 333 4.0E-37
sp|Q5KWJ4|LEU3_GEOKA 3-isopropylmalate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=leuB PE=3 SV=1 16 348 6.0E-37
sp|O67480|IDH_AQUAE Isocitrate dehydrogenase [NADP] OS=Aquifex aeolicus (strain VF5) GN=icd PE=3 SV=1 20 325 7.0E-37
sp|P61494|LEU3_THET2 3-isopropylmalate dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=leuB PE=3 SV=1 20 347 8.0E-37
sp|A4QDP9|LEU3_CORGB 3-isopropylmalate dehydrogenase OS=Corynebacterium glutamicum (strain R) GN=leuB PE=3 SV=1 20 324 9.0E-37
sp|P94631|LEU3_CORGL 3-isopropylmalate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuB PE=3 SV=1 20 324 1.0E-36
sp|Q5SIY4|LEU3_THET8 3-isopropylmalate dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=leuB PE=1 SV=1 20 347 1.0E-36
sp|P41019|LEU3_BACMD 3-isopropylmalate dehydrogenase OS=Bacillus megaterium (strain DSM 319) GN=leuB PE=3 SV=2 20 336 3.0E-36
sp|B7GUI8|LEU3_BIFLS 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuB PE=3 SV=1 18 335 3.0E-36
sp|Q9RTH9|LEU3_DEIRA 3-isopropylmalate dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuB PE=3 SV=1 20 350 4.0E-36
sp|Q8G500|LEU3_BIFLO 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=leuB PE=3 SV=1 18 335 5.0E-36
sp|B3DTF8|LEU3_BIFLD 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum (strain DJO10A) GN=leuB PE=3 SV=1 18 335 5.0E-36
sp|Q2RGA0|LEU3_MOOTA 3-isopropylmalate dehydrogenase OS=Moorella thermoacetica (strain ATCC 39073) GN=leuB PE=3 SV=1 18 333 6.0E-36
sp|Q5WEN4|LEU3_BACSK 3-isopropylmalate dehydrogenase OS=Bacillus clausii (strain KSM-K16) GN=leuB PE=3 SV=1 20 352 6.0E-36
sp|P76251|DMLA_ECOLI D-malate dehydrogenase [decarboxylating] OS=Escherichia coli (strain K12) GN=dmlA PE=1 SV=1 20 346 8.0E-36
sp|Q5LWZ5|LEU3_RUEPO 3-isopropylmalate dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuB PE=3 SV=1 19 352 1.0E-35
sp|Q5NPQ9|LEU3_ZYMMO 3-isopropylmalate dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuB PE=3 SV=1 20 347 2.0E-35
sp|P70792|TTUC4_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 17 350 2.0E-35
sp|Q51945|TTUC_PSEPU Tartrate dehydrogenase/decarboxylase OS=Pseudomonas putida PE=1 SV=3 18 350 2.0E-35
sp|P12010|LEU3_BACCO 3-isopropylmalate dehydrogenase OS=Bacillus coagulans GN=leuB PE=1 SV=1 17 350 2.0E-35
sp|C3PFX5|LEU3_CORA7 3-isopropylmalate dehydrogenase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=leuB PE=3 SV=1 20 334 3.0E-35
sp|P70787|TTUC2_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 17 350 3.0E-35
sp|Q65V05|LEU3_MANSM 3-isopropylmalate dehydrogenase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuB PE=3 SV=1 18 338 4.0E-35
sp|P42958|TTUC_BACSU Probable tartrate dehydrogenase/decarboxylase OS=Bacillus subtilis (strain 168) GN=ycsA PE=3 SV=4 17 350 4.0E-35
sp|Q3AYS1|LEU3_SYNS9 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain CC9902) GN=leuB PE=3 SV=1 17 350 7.0E-35
sp|Q67JY2|LEU3_SYMTH 3-isopropylmalate dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuB PE=3 SV=1 18 350 7.0E-35
sp|Q2Y7Q8|LEU3_NITMU 3-isopropylmalate dehydrogenase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=leuB PE=3 SV=1 20 333 9.0E-35
sp|Q9WZ26|LEU3_THEMA 3-isopropylmalate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuB PE=1 SV=1 20 351 9.0E-35
sp|Q2G4X5|LEU3_NOVAD 3-isopropylmalate dehydrogenase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuB PE=3 SV=2 20 350 9.0E-35
sp|Q82JN6|LEU3_STRAW 3-isopropylmalate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuB PE=3 SV=1 20 339 1.0E-34
sp|Q2KYL5|LEU3_BORA1 3-isopropylmalate dehydrogenase OS=Bordetella avium (strain 197N) GN=leuB PE=3 SV=1 20 348 2.0E-34
sp|P59028|LEU3_CHLTE 3-isopropylmalate dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=leuB PE=3 SV=1 18 350 2.0E-34
sp|Q81G11|LEU3_BACCR 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuB PE=3 SV=1 20 351 4.0E-34
sp|Q44471|TTUC1_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 17 350 5.0E-34
sp|Q8EN68|LEU3_OCEIH 3-isopropylmalate dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuB PE=3 SV=1 20 350 7.0E-34
sp|O34296|TTUC3_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 17 350 7.0E-34
sp|Q8FPV5|LEU3_COREF 3-isopropylmalate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuB PE=3 SV=2 20 334 8.0E-34
sp|Q7W929|LEU3_BORPA 3-isopropylmalate dehydrogenase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuB PE=3 SV=2 18 348 9.0E-34
sp|Q7WKH4|LEU32_BORBR 3-isopropylmalate dehydrogenase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuB2 PE=3 SV=1 18 348 9.0E-34
sp|Q30RK2|LEU3_SULDN 3-isopropylmalate dehydrogenase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuB PE=3 SV=1 18 333 1.0E-33
sp|Q73B99|LEU3_BACC1 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuB PE=3 SV=1 20 351 1.0E-33
sp|Q56268|LEU3_ACIFR 3-isopropylmalate dehydrogenase OS=Acidithiobacillus ferrooxidans GN=leuB PE=1 SV=1 20 346 1.0E-33
sp|Q3APC4|LEU3_CHLCH 3-isopropylmalate dehydrogenase OS=Chlorobium chlorochromatii (strain CaD3) GN=leuB PE=3 SV=1 18 351 1.0E-33
sp|P73960|LEU3_SYNY3 3-isopropylmalate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuB PE=3 SV=1 18 350 1.0E-33
sp|Q8ZIG9|LEU3_YERPE 3-isopropylmalate dehydrogenase OS=Yersinia pestis GN=leuB PE=3 SV=2 18 346 1.0E-33
sp|O34295|TTUC5_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 17 350 1.0E-33
sp|Q3B595|LEU3_CHLL7 3-isopropylmalate dehydrogenase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=leuB PE=3 SV=1 18 352 1.0E-33
sp|Q9EVI1|LEU3_BUCUO 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuB PE=3 SV=1 17 338 2.0E-33
sp|Q7N128|LEU3_PHOLL 3-isopropylmalate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuB PE=3 SV=1 18 336 2.0E-33
sp|Q5HMF8|LEU3_STAEQ 3-isopropylmalate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuB PE=3 SV=1 18 349 2.0E-33
sp|Q81T67|LEU3_BACAN 3-isopropylmalate dehydrogenase OS=Bacillus anthracis GN=leuB PE=3 SV=1 20 351 2.0E-33
sp|Q24XT2|LEU3_DESHY 3-isopropylmalate dehydrogenase OS=Desulfitobacterium hafniense (strain Y51) GN=leuB PE=3 SV=1 20 333 2.0E-33
sp|Q47HR1|LEU31_DECAR 3-isopropylmalate dehydrogenase 1 OS=Dechloromonas aromatica (strain RCB) GN=leuB1 PE=3 SV=1 20 334 3.0E-33
sp|Q2NVW4|LEU3_SODGM 3-isopropylmalate dehydrogenase OS=Sodalis glossinidius (strain morsitans) GN=leuB PE=3 SV=1 18 339 3.0E-33
sp|Q66EM2|LEU3_YERPS 3-isopropylmalate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuB PE=3 SV=2 18 346 4.0E-33
sp|Q47SB4|LEU3_THEFY 3-isopropylmalate dehydrogenase OS=Thermobifida fusca (strain YX) GN=leuB PE=3 SV=1 20 307 4.0E-33
sp|Q6AEP6|LEU3_LEIXX 3-isopropylmalate dehydrogenase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuB PE=3 SV=1 20 346 5.0E-33
sp|Q46LE2|LEU3_PROMT 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain NATL2A) GN=leuB PE=3 SV=1 18 341 5.0E-33
sp|Q8RDK0|LEU3_CALS4 3-isopropylmalate dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuB PE=3 SV=1 18 334 5.0E-33
sp|Q2JTN8|LEU3_SYNJA 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuB PE=3 SV=1 128 339 5.0E-33
sp|Q3JCC4|LEU3_NITOC 3-isopropylmalate dehydrogenase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuB PE=3 SV=1 20 348 5.0E-33
sp|Q4L7U1|LEU3_STAHJ 3-isopropylmalate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuB PE=3 SV=1 18 341 8.0E-33
sp|Q63DX7|LEU3_BACCZ 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=leuB PE=3 SV=1 20 351 8.0E-33
sp|Q8CNL2|LEU3_STAES 3-isopropylmalate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuB PE=3 SV=1 18 349 8.0E-33
sp|Q6NHM7|LEU3_CORDI 3-isopropylmalate dehydrogenase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuB PE=3 SV=1 20 334 9.0E-33
sp|Q5H4C7|LEU3_XANOR 3-isopropylmalate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuB PE=3 SV=1 20 352 1.0E-32
sp|Q2P762|LEU3_XANOM 3-isopropylmalate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuB PE=3 SV=1 20 352 1.0E-32
sp|Q7NUC2|LEU3_CHRVO 3-isopropylmalate dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuB PE=3 SV=1 20 333 1.0E-32
sp|Q3BPJ8|LEU3_XANC5 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuB PE=3 SV=1 20 352 1.0E-32
sp|Q6G7Q0|LEU3_STAAS 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=leuB PE=3 SV=1 18 350 2.0E-32
sp|P65101|LEU3_STAAN 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=leuB PE=3 SV=1 18 350 2.0E-32
sp|P65100|LEU3_STAAM 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuB PE=3 SV=1 18 350 2.0E-32
sp|O66607|LEU3_AQUAE 3-isopropylmalate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=leuB PE=3 SV=1 17 350 2.0E-32
sp|Q2JL30|LEU3_SYNJB 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuB PE=3 SV=1 18 339 2.0E-32
sp|Q6HLF2|LEU3_BACHK 3-isopropylmalate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuB PE=3 SV=1 20 351 2.0E-32
sp|Q9EVG9|LEU3_BUCUM 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuB PE=3 SV=1 17 338 3.0E-32
sp|Q9K8E9|LEU3_BACHD 3-isopropylmalate dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuB PE=3 SV=1 20 348 3.0E-32
sp|Q7VY73|LEU3_BORPE 3-isopropylmalate dehydrogenase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuB PE=3 SV=1 18 348 3.0E-32
sp|Q5HEE3|LEU3_STAAC 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=leuB PE=3 SV=1 18 350 3.0E-32
sp|Q2FF66|LEU3_STAA3 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=leuB PE=3 SV=1 18 350 3.0E-32
sp|Q21XI1|LEU3_RHOFT 3-isopropylmalate dehydrogenase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=leuB PE=3 SV=1 20 340 3.0E-32
sp|P93832|LEU32_ARATH 3-isopropylmalate dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=IMDH2 PE=1 SV=1 4 333 4.0E-32
sp|Q2YUF1|LEU3_STAAB 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuB PE=3 SV=1 18 350 4.0E-32
sp|Q8NVJ0|LEU3_STAAW 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=leuB PE=3 SV=1 18 350 5.0E-32
sp|Q2FWK2|LEU3_STAA8 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=leuB PE=3 SV=1 18 350 5.0E-32
sp|Q32K21|LEU3_SHIDS 3-isopropylmalate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuB PE=3 SV=2 18 333 5.0E-32
sp|Q6D0G7|LEU3_PECAS 3-isopropylmalate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuB PE=3 SV=1 18 337 5.0E-32
sp|Q7U840|LEU3_SYNPX 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain WH8102) GN=leuB PE=3 SV=1 17 350 5.0E-32
sp|Q7VQJ7|LEU3_BLOFL 3-isopropylmalate dehydrogenase OS=Blochmannia floridanus GN=leuB PE=3 SV=1 18 336 6.0E-32
sp|Q7M886|LEU3_WOLSU 3-isopropylmalate dehydrogenase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuB PE=3 SV=1 17 333 6.0E-32
sp|Q6GF15|LEU3_STAAR 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=leuB PE=3 SV=1 18 350 7.0E-32
sp|Q3AEQ2|LEU3_CARHZ 3-isopropylmalate dehydrogenase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuB PE=3 SV=1 16 339 7.0E-32
sp|A5CPZ4|LEU3_CLAM3 3-isopropylmalate dehydrogenase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=leuB PE=3 SV=1 19 324 7.0E-32
sp|P29102|LEU3_BRANA 3-isopropylmalate dehydrogenase, chloroplastic OS=Brassica napus PE=2 SV=1 17 333 8.0E-32
sp|Q31HI0|LEU3_THICR 3-isopropylmalate dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=leuB PE=3 SV=1 20 352 8.0E-32
sp|Q4JUQ0|LEU3_CORJK 3-isopropylmalate dehydrogenase OS=Corynebacterium jeikeium (strain K411) GN=leuB PE=3 SV=1 20 334 9.0E-32
sp|Q5E857|LEU3_VIBF1 3-isopropylmalate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuB PE=3 SV=1 18 350 1.0E-31
sp|Q7NFH4|LEU3_GLOVI 3-isopropylmalate dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=leuB PE=3 SV=1 15 333 1.0E-31
sp|Q7V842|LEU3_PROMM 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuB PE=3 SV=1 17 340 1.0E-31
sp|Q31B91|LEU3_PROM9 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuB PE=3 SV=1 18 350 1.0E-31
sp|Q9FMT1|LEU33_ARATH 3-isopropylmalate dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=IMDH3 PE=1 SV=1 17 333 1.0E-31
sp|C1B2M3|LEU3_RHOOB 3-isopropylmalate dehydrogenase OS=Rhodococcus opacus (strain B4) GN=leuB PE=3 SV=1 20 334 2.0E-31
sp|Q3SHL3|LEU3_THIDA 3-isopropylmalate dehydrogenase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuB PE=3 SV=1 20 338 2.0E-31
sp|Q8FL76|LEU3_ECOL6 3-isopropylmalate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuB PE=3 SV=3 18 333 2.0E-31
sp|Q1QUR0|LEU3_CHRSD 3-isopropylmalate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=leuB PE=3 SV=2 20 352 2.0E-31
sp|Q5MZ40|LEU3_SYNP6 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuB PE=3 SV=2 18 352 2.0E-31
sp|Q31N34|LEU3_SYNE7 3-isopropylmalate dehydrogenase OS=Synechococcus elongatus (strain PCC 7942) GN=leuB PE=3 SV=1 18 352 2.0E-31
sp|Q49Z13|LEU3_STAS1 3-isopropylmalate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuB PE=3 SV=1 18 350 3.0E-31
sp|P05644|LEU3_BACCA 3-isopropylmalate dehydrogenase OS=Bacillus caldotenax GN=leuB PE=3 SV=1 16 348 3.0E-31
sp|Q9EVG6|LEU3_BUCUA 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon aeneum GN=leuB PE=3 SV=1 17 337 3.0E-31
sp|Q0S2H1|LEU3_RHOJR 3-isopropylmalate dehydrogenase OS=Rhodococcus jostii (strain RHA1) GN=leuB PE=3 SV=1 20 334 3.0E-31
sp|Q5YRX2|LEU3_NOCFA 3-isopropylmalate dehydrogenase OS=Nocardia farcinica (strain IFM 10152) GN=leuB PE=3 SV=1 20 307 3.0E-31
sp|Q8X9Z9|LEU3_ECO57 3-isopropylmalate dehydrogenase OS=Escherichia coli O157:H7 GN=leuB PE=3 SV=3 18 333 3.0E-31
sp|Q9KP82|LEU3_VIBCH 3-isopropylmalate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuB PE=3 SV=1 18 350 3.0E-31
sp|Q1RGC4|LEU3_ECOUT 3-isopropylmalate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=leuB PE=3 SV=1 18 333 4.0E-31
sp|Q28W67|LEU3_JANSC 3-isopropylmalate dehydrogenase OS=Jannaschia sp. (strain CCS1) GN=leuB PE=3 SV=1 19 352 4.0E-31
sp|Q3IZJ3|LEU3_RHOS4 3-isopropylmalate dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuB PE=3 SV=2 19 335 5.0E-31
sp|Q8PH05|LEU3_XANAC 3-isopropylmalate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuB PE=3 SV=1 20 352 5.0E-31
sp|Q83SP1|LEU3_SHIFL 3-isopropylmalate dehydrogenase OS=Shigella flexneri GN=leuB PE=3 SV=3 18 333 6.0E-31
sp|Q7MP78|LEU3_VIBVY 3-isopropylmalate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=leuB PE=3 SV=1 18 336 6.0E-31
sp|A8L554|LEU3_FRASN 3-isopropylmalate dehydrogenase OS=Frankia sp. (strain EAN1pec) GN=leuB PE=3 SV=1 20 315 6.0E-31
sp|Q326G2|LEU3_SHIBS 3-isopropylmalate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=leuB PE=3 SV=2 18 333 8.0E-31
sp|P48572|LEU3_BUCRP 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=leuB PE=3 SV=1 17 333 9.0E-31
sp|Q3Z5T7|LEU3_SHISS 3-isopropylmalate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=leuB PE=3 SV=2 18 333 1.0E-30
sp|P30125|LEU3_ECOLI 3-isopropylmalate dehydrogenase OS=Escherichia coli (strain K12) GN=leuB PE=1 SV=3 18 333 1.0E-30
sp|Q8DEE0|LEU3_VIBVU 3-isopropylmalate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=leuB PE=3 SV=1 18 336 1.0E-30
sp|Q9SA14|LEU31_ARATH 3-isopropylmalate dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=IMDH1 PE=2 SV=2 17 333 1.0E-30
sp|Q3AIH4|LEU3_SYNSC 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain CC9605) GN=leuB PE=3 SV=1 17 304 1.0E-30
sp|Q3M8T9|LEU3_ANAVT 3-isopropylmalate dehydrogenase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuB PE=3 SV=1 18 333 1.0E-30
sp|Q87BQ1|LEU3_XYLFT 3-isopropylmalate dehydrogenase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuB PE=3 SV=1 20 352 1.0E-30
sp|Q8YXA2|LEU3_NOSS1 3-isopropylmalate dehydrogenase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuB PE=3 SV=1 18 333 1.0E-30
sp|Q9JZI9|LEU3_NEIMB 3-isopropylmalate dehydrogenase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuB PE=3 SV=1 20 333 1.0E-30
sp|Q9EVE1|LEU3_BUCUD 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon rudbeckiae GN=leuB PE=3 SV=1 17 338 1.0E-30
sp|Q606F4|LEU3_METCA 3-isopropylmalate dehydrogenase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuB PE=3 SV=1 20 352 2.0E-30
sp|Q9PAX3|LEU3_XYLFA 3-isopropylmalate dehydrogenase OS=Xylella fastidiosa (strain 9a5c) GN=leuB PE=3 SV=1 20 352 2.0E-30
sp|Q8A6M0|LEU3_BACTN 3-isopropylmalate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuB PE=3 SV=1 18 351 3.0E-30
sp|P96197|LEU3_AZOVI 3-isopropylmalate dehydrogenase OS=Azotobacter vinelandii GN=leuB PE=3 SV=1 20 333 3.0E-30
sp|Q5P1J6|LEU3_AROAE 3-isopropylmalate dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=leuB PE=3 SV=1 20 352 3.0E-30
sp|Q8DTG3|LEU3_STRMU 3-isopropylmalate dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=leuB PE=3 SV=1 17 350 4.0E-30
sp|Q82WI6|LEU3_NITEU 3-isopropylmalate dehydrogenase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuB PE=3 SV=1 20 333 4.0E-30
sp|Q9CJN6|LEU3_PASMU 3-isopropylmalate dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=leuB PE=3 SV=1 18 337 4.0E-30
sp|Q87SS8|LEU3_VIBPA 3-isopropylmalate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuB PE=3 SV=1 18 346 5.0E-30
sp|Q8Z9I1|LEU3_SALTI 3-isopropylmalate dehydrogenase OS=Salmonella typhi GN=leuB PE=3 SV=1 18 333 5.0E-30
sp|Q3IJS3|LEU3_PSEHT 3-isopropylmalate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuB PE=3 SV=1 18 317 5.0E-30
sp|B1VG35|LEU3_CORU7 3-isopropylmalate dehydrogenase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=leuB PE=3 SV=1 20 319 6.0E-30
sp|Q97EE2|LEU3_CLOAB 3-isopropylmalate dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuB PE=3 SV=1 17 334 7.0E-30
sp|Q9EVH5|LEU3_BUCUE 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuB PE=3 SV=1 17 345 8.0E-30
sp|Q2SJD6|LEU3_HAHCH 3-isopropylmalate dehydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=leuB PE=3 SV=1 20 346 9.0E-30
sp|P54354|LEU3_BACFR 3-isopropylmalate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=leuB PE=3 SV=1 18 348 1.0E-29
sp|Q5LAB4|LEU3_BACFN 3-isopropylmalate dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuB PE=3 SV=1 18 348 1.0E-29
sp|Q9JU79|LEU3_NEIMA 3-isopropylmalate dehydrogenase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuB PE=3 SV=1 20 333 1.0E-29
sp|Q48K97|LEU3_PSE14 3-isopropylmalate dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuB PE=3 SV=1 128 333 1.0E-29
sp|O85071|LEU3_BUCDN 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuB PE=3 SV=1 17 353 2.0E-29
sp|Q726X1|LEU3_DESVH 3-isopropylmalate dehydrogenase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuB PE=3 SV=1 20 339 2.0E-29
sp|Q63JL2|LEU3_BURPS 3-isopropylmalate dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=leuB PE=3 SV=1 20 352 2.0E-29
sp|Q3JKG9|LEU3_BURP1 3-isopropylmalate dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=leuB PE=3 SV=1 20 352 2.0E-29
sp|Q62AI9|LEU3_BURMA 3-isopropylmalate dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=leuB PE=3 SV=1 20 352 2.0E-29
sp|Q9EVG3|LEU3_BUCML 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae GN=leuB PE=3 SV=1 17 350 2.0E-29
sp|P43860|LEU3_HAEIN 3-isopropylmalate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuB PE=3 SV=1 18 338 2.0E-29
sp|Q8DPJ4|LEU3_STRR6 3-isopropylmalate dehydrogenase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=leuB PE=3 SV=1 16 350 2.0E-29
sp|Q7UIE1|LEU3_RHOBA 3-isopropylmalate dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuB PE=3 SV=2 19 350 3.0E-29
sp|A0PPY6|LEU3_MYCUA 3-isopropylmalate dehydrogenase OS=Mycobacterium ulcerans (strain Agy99) GN=leuB PE=3 SV=1 20 331 3.0E-29
sp|P37412|LEU3_SALTY 3-isopropylmalate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuB PE=1 SV=2 18 333 3.0E-29
sp|Q57TE7|LEU3_SALCH 3-isopropylmalate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=leuB PE=3 SV=1 18 333 3.0E-29
sp|O85064|LEU3_BUCAP 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuB PE=3 SV=1 17 333 3.0E-29
sp|Q5PDG2|LEU3_SALPA 3-isopropylmalate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuB PE=3 SV=1 18 333 3.0E-29
sp|B2HIH1|LEU3_MYCMM 3-isopropylmalate dehydrogenase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuB PE=3 SV=1 20 331 4.0E-29
sp|P56933|LEU3_BUCAI 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuB PE=3 SV=2 18 350 4.0E-29
sp|O31292|LEU3_BUCTS 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuB PE=3 SV=1 18 350 4.0E-29
sp|Q4ZUZ4|LEU3_PSEU2 3-isopropylmalate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=leuB PE=3 SV=1 128 333 4.0E-29
sp|Q39Y29|LEU3_GEOMG 3-isopropylmalate dehydrogenase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuB PE=3 SV=1 18 333 5.0E-29
sp|B0RIP4|LEU3_CLAMS 3-isopropylmalate dehydrogenase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=leuB PE=3 SV=1 19 310 7.0E-29
sp|Q8P5L1|LEU3_XANCP 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuB PE=3 SV=1 20 352 7.0E-29
sp|Q4UYG2|LEU3_XANC8 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuB PE=3 SV=1 20 352 7.0E-29
sp|Q5F8T6|LEU3_NEIG1 3-isopropylmalate dehydrogenase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuB PE=3 SV=1 20 333 7.0E-29
sp|P50180|LEU3_NEILA 3-isopropylmalate dehydrogenase (Fragment) OS=Neisseria lactamica GN=leuB PE=3 SV=1 20 312 1.0E-28
sp|Q7VC80|LEU3_PROMA 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuB PE=3 SV=1 18 342 1.0E-28
sp|Q3KF21|LEU3_PSEPF 3-isopropylmalate dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=leuB PE=3 SV=1 128 352 1.0E-28
sp|Q4QLS3|LEU3_HAEI8 3-isopropylmalate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=leuB PE=3 SV=1 18 338 1.0E-28
sp|Q479H7|LEU32_DECAR 3-isopropylmalate dehydrogenase 2 OS=Dechloromonas aromatica (strain RCB) GN=leuB2 PE=3 SV=1 20 333 1.0E-28
sp|Q6FEV6|LEU3_ACIAD 3-isopropylmalate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuB PE=3 SV=1 20 333 1.0E-28
sp|Q748X2|LEU3_GEOSL 3-isopropylmalate dehydrogenase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuB PE=3 SV=1 18 333 2.0E-28
sp|Q00412|LEU3_ARTPT 3-isopropylmalate dehydrogenase OS=Arthrospira platensis GN=leuB PE=3 SV=1 18 326 2.0E-28
sp|Q9EVH8|LEU3_BUCUH 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuB PE=3 SV=1 17 338 2.0E-28
sp|P59027|LEU3_BUCPS 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuB PE=3 SV=1 18 348 4.0E-28
sp|Q2IJK7|LEU3_ANADE 3-isopropylmalate dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuB PE=3 SV=1 113 350 4.0E-28
sp|Q393X4|LEU3_BURL3 3-isopropylmalate dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuB PE=3 SV=1 20 333 4.0E-28
sp|C0ZXM4|LEU3_RHOE4 3-isopropylmalate dehydrogenase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=leuB PE=3 SV=1 20 334 5.0E-28
sp|Q4KF05|LEU3_PSEF5 3-isopropylmalate dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuB PE=3 SV=1 128 352 5.0E-28
sp|Q493R1|LEU3_BLOPB 3-isopropylmalate dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuB PE=3 SV=1 18 334 5.0E-28
sp|Q8XXX5|LEU3_RALSO 3-isopropylmalate dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=leuB PE=3 SV=2 20 333 5.0E-28
sp|Q7VH33|LEU3_HELHP 3-isopropylmalate dehydrogenase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuB PE=3 SV=2 20 333 6.0E-28
sp|C1AGB0|LEU3_MYCBT 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuB PE=3 SV=1 20 334 6.0E-28
sp|A1KMY9|LEU3_MYCBP 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuB PE=3 SV=1 20 334 6.0E-28
sp|P94929|LEU3_MYCBO 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuB PE=3 SV=1 20 334 6.0E-28
sp|Q6LV25|LEU3_PHOPR 3-isopropylmalate dehydrogenase OS=Photobacterium profundum GN=leuB PE=3 SV=1 16 336 6.0E-28
sp|Q845W3|LEU3_BURM1 3-isopropylmalate dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuB PE=3 SV=1 20 352 6.0E-28
sp|P24015|LEU3_LEPIN 3-isopropylmalate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuB PE=3 SV=1 20 352 7.0E-28
sp|Q72RH7|LEU3_LEPIC 3-isopropylmalate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuB PE=3 SV=1 20 352 7.0E-28
sp|A4TE12|LEU3_MYCGI 3-isopropylmalate dehydrogenase OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuB PE=3 SV=1 20 319 7.0E-28
sp|A4FMQ2|LEU3_SACEN 3-isopropylmalate dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuB PE=3 SV=1 20 307 7.0E-28
sp|Q46YW0|LEU3_CUPPJ 3-isopropylmalate dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuB PE=3 SV=1 20 334 9.0E-28
sp|Q884C0|LEU3_PSESM 3-isopropylmalate dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=leuB PE=3 SV=1 128 352 1.0E-27
sp|Q5FUG5|LEU3_GLUOX 3-isopropylmalate dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=leuB PE=3 SV=1 18 351 1.0E-27
sp|Q51375|LEU3_PSEAE 3-isopropylmalate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuB PE=3 SV=2 20 334 1.0E-27
sp|Q7V1R9|LEU3_PROMP 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuB PE=3 SV=1 17 333 1.0E-27
sp|Q5M405|LEU3_STRT2 3-isopropylmalate dehydrogenase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuB PE=3 SV=2 17 350 1.0E-27
sp|Q5LZF3|LEU3_STRT1 3-isopropylmalate dehydrogenase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=leuB PE=3 SV=2 17 350 1.0E-27
sp|P59029|LEU3_THEEB 3-isopropylmalate dehydrogenase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuB PE=3 SV=1 18 305 1.0E-27
sp|P9WKK9|LEU3_MYCTU 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuB PE=1 SV=1 20 334 1.0E-27
sp|P9WKK8|LEU3_MYCTO 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuB PE=3 SV=1 20 334 1.0E-27
sp|A5U706|LEU3_MYCTA 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuB PE=3 SV=1 20 334 1.0E-27
sp|Q1BAR4|LEU3_MYCSS 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain MCS) GN=leuB PE=3 SV=1 20 321 2.0E-27
sp|A1UE98|LEU3_MYCSK 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain KMS) GN=leuB PE=3 SV=1 20 321 2.0E-27
sp|A3PXQ2|LEU3_MYCSJ 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain JLS) GN=leuB PE=3 SV=1 20 321 2.0E-27
sp|Q5WPZ9|LEU3_BUCCC 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuB PE=3 SV=1 17 333 2.0E-27
sp|Q2T7H6|LEU3_BURTA 3-isopropylmalate dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuB PE=1 SV=1 20 352 2.0E-27
sp|Q21IY5|LEU3_SACD2 3-isopropylmalate dehydrogenase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuB PE=3 SV=1 20 305 2.0E-27
sp|Q88LE5|LEU3_PSEPK 3-isopropylmalate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=leuB PE=3 SV=1 20 333 3.0E-27
sp|Q9ABN3|LEU3_CAUCR 3-isopropylmalate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuB PE=3 SV=1 19 347 3.0E-27
sp|Q1LKH7|LEU3_CUPMC 3-isopropylmalate dehydrogenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=leuB PE=3 SV=1 20 333 3.0E-27
sp|Q9EVI4|LEU3_BUCUS 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuB PE=3 SV=1 17 337 4.0E-27
sp|Q9EVI7|LEU3_BUCUN 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuB PE=3 SV=1 17 350 4.0E-27
sp|Q3A3B2|LEU3_PELCD 3-isopropylmalate dehydrogenase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=leuB PE=3 SV=1 17 333 4.0E-27
sp|Q6TWC4|LEU3_SORMA 3-isopropylmalate dehydrogenase OS=Sordaria macrospora GN=LEU1 PE=3 SV=1 102 351 5.0E-27
sp|Q6ANR1|LEU3_DESPS 3-isopropylmalate dehydrogenase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=leuB PE=3 SV=1 20 326 6.0E-27
sp|Q30WD0|LEU3_DESAG 3-isopropylmalate dehydrogenase OS=Desulfovibrio alaskensis (strain G20) GN=leuB PE=3 SV=1 20 333 6.0E-27
sp|Q12545|LEU3_ACRCH 3-isopropylmalate dehydrogenase OS=Acremonium chrysogenum GN=LEU2 PE=3 SV=1 18 350 9.0E-27
sp|P59515|LEU3_BUCBP 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuB PE=3 SV=1 18 337 9.0E-27
sp|Q89X19|LEU32_BRADU 3-isopropylmalate dehydrogenase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuB2 PE=3 SV=1 18 351 9.0E-27
sp|P34738|LEU3_NEUCR 3-isopropylmalate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-1 PE=3 SV=2 102 351 1.0E-26
sp|Q8E9N3|LEU3_SHEON 3-isopropylmalate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=leuB PE=1 SV=1 18 326 1.0E-26
sp|P31958|LEU3_CLOPA 3-isopropylmalate dehydrogenase OS=Clostridium pasteurianum GN=leuB PE=3 SV=1 17 350 1.0E-26
sp|Q2S0M8|LEU3_SALRD 3-isopropylmalate dehydrogenase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuB PE=3 SV=2 17 346 2.0E-26
sp|Q2J6V8|LEU3_FRASC 3-isopropylmalate dehydrogenase OS=Frankia sp. (strain CcI3) GN=leuB PE=3 SV=1 20 307 2.0E-26
sp|Q3SNU3|LEU3_NITWN 3-isopropylmalate dehydrogenase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuB PE=3 SV=1 18 352 2.0E-26
sp|Q47WG3|LEU3_COLP3 3-isopropylmalate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuB PE=3 SV=1 19 305 2.0E-26
sp|Q2RV53|LEU3_RHORT 3-isopropylmalate dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuB PE=3 SV=1 102 333 2.0E-26
sp|Q4FRV0|LEU3_PSYA2 3-isopropylmalate dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuB PE=3 SV=1 19 333 6.0E-26
sp|A1T6Z4|LEU3_MYCVP 3-isopropylmalate dehydrogenase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuB PE=3 SV=1 20 319 7.0E-26
sp|Q92A27|LEU3_LISIN 3-isopropylmalate dehydrogenase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuB PE=3 SV=1 18 351 8.0E-26
sp|Q8FVF3|LEU3_BRUSU 3-isopropylmalate dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=leuB PE=3 SV=1 20 352 9.0E-26
sp|Q2VZV2|LEU3_MAGSA 3-isopropylmalate dehydrogenase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuB PE=3 SV=1 20 333 1.0E-25
sp|Q8Y5R8|LEU3_LISMO 3-isopropylmalate dehydrogenase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuB PE=3 SV=1 18 351 1.0E-25
sp|Q21CS1|LEU3_RHOPB 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain BisB18) GN=leuB PE=3 SV=2 18 352 1.0E-25
sp|Q8YCX4|LEU3_BRUME 3-isopropylmalate dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuB PE=3 SV=1 20 352 1.0E-25
sp|Q579B1|LEU3_BRUAB 3-isopropylmalate dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=leuB PE=3 SV=1 20 352 2.0E-25
sp|Q2YL58|LEU3_BRUA2 3-isopropylmalate dehydrogenase OS=Brucella abortus (strain 2308) GN=leuB PE=3 SV=1 20 352 2.0E-25
sp|Q6ND82|LEU3_RHOPA 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuB PE=3 SV=1 18 352 2.0E-25
sp|P87256|LEU3A_ASPNG 3-isopropylmalate dehydrogenase A OS=Aspergillus niger GN=leu2A PE=2 SV=1 109 351 2.0E-25
sp|Q71Y34|LEU3_LISMF 3-isopropylmalate dehydrogenase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuB PE=3 SV=1 18 351 3.0E-25
sp|Q4FP17|LEU3_PELUB 3-isopropylmalate dehydrogenase OS=Pelagibacter ubique (strain HTCC1062) GN=leuB PE=3 SV=1 128 348 4.0E-25
sp|O33117|LEU3_MYCLE 3-isopropylmalate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=leuB PE=3 SV=1 20 334 4.0E-25
sp|B8ZS15|LEU3_MYCLB 3-isopropylmalate dehydrogenase OS=Mycobacterium leprae (strain Br4923) GN=leuB PE=3 SV=1 20 334 4.0E-25
sp|Q1QAF5|LEU3_PSYCK 3-isopropylmalate dehydrogenase OS=Psychrobacter cryohalolentis (strain K5) GN=leuB PE=3 SV=1 19 305 6.0E-25
sp|P87257|LEU3B_ASPNG 3-isopropylmalate dehydrogenase B OS=Aspergillus niger GN=leu2B PE=2 SV=1 18 351 1.0E-24
sp|Q89XA0|LEU31_BRADU 3-isopropylmalate dehydrogenase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuB1 PE=3 SV=2 19 351 2.0E-24
sp|Q98E57|LEU3_RHILO 3-isopropylmalate dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=leuB PE=3 SV=1 22 333 3.0E-24
sp|A0QJC2|LEU3_MYCA1 3-isopropylmalate dehydrogenase OS=Mycobacterium avium (strain 104) GN=leuB PE=3 SV=1 119 324 5.0E-24
sp|P24404|LEU3_AGRFC 3-isopropylmalate dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuB PE=3 SV=2 19 352 6.0E-24
sp|Q73VI1|LEU3_MYCPA 3-isopropylmalate dehydrogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuB PE=3 SV=1 119 324 6.0E-24
sp|Q2J3B4|LEU3_RHOP2 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain HaA2) GN=leuB PE=3 SV=1 18 352 8.0E-24
sp|P18869|LEU3_SCHPO 3-isopropylmalate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu1 PE=1 SV=1 20 351 1.0E-23
sp|Q9Y897|LEU3_ZYMTR 3-isopropylmalate dehydrogenase OS=Zymoseptoria tritici GN=LEUC PE=3 SV=1 108 352 1.0E-23
sp|Q2K2V0|LEU3_RHIEC 3-isopropylmalate dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuB PE=3 SV=1 22 352 3.0E-23
sp|Q96WI0|LEU3_ZYGRC 3-isopropylmalate dehydrogenase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LEU2 PE=3 SV=1 100 346 9.0E-23
sp|P41926|LEU3_KODOH 3-isopropylmalate dehydrogenase OS=Kodamaea ohmeri GN=LEU2 PE=3 SV=1 19 351 1.0E-22
sp|O60027|LEU3_ASHGO 3-isopropylmalate dehydrogenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU2 PE=3 SV=1 20 346 1.0E-22
sp|Q6PY58|LEU3_CANHU 3-isopropylmalate dehydrogenase OS=Candida humilis GN=LEU2 PE=3 SV=1 19 346 1.0E-22
sp|P04173|LEU3_YEAST 3-isopropylmalate dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU2 PE=1 SV=4 20 351 1.0E-22
sp|P34733|LEU3_PICAN 3-isopropylmalate dehydrogenase OS=Pichia angusta GN=LEU2 PE=3 SV=1 20 346 1.0E-22
sp|Q3ZXI7|LEU3_DEHMC 3-isopropylmalate dehydrogenase OS=Dehalococcoides mccartyi (strain CBDB1) GN=leuB PE=3 SV=1 18 326 1.0E-22
sp|Q1MA50|LEU3_RHIL3 3-isopropylmalate dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuB PE=3 SV=1 22 347 1.0E-22
sp|Q9HDQ5|LEU3_CANRU 3-isopropylmalate dehydrogenase OS=Candida rugosa GN=LEU2 PE=3 SV=1 19 351 2.0E-22
sp|Q92KY8|LEU3_RHIME 3-isopropylmalate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=leuB PE=3 SV=1 22 352 4.0E-22
sp|Q96WT9|LEU3_SACEX 3-isopropylmalate dehydrogenase OS=Saccharomyces exiguus GN=LEU2 PE=3 SV=1 20 346 1.0E-21
sp|Q9PLW0|LEU3_CAMJE 3-isopropylmalate dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuB PE=1 SV=1 18 348 1.0E-21
sp|Q9HDQ1|LEU3_WICAO 3-isopropylmalate dehydrogenase OS=Wickerhamomyces anomalus GN=LEU2 PE=3 SV=1 19 348 4.0E-21
sp|Q6B458|LEU3_DEBHA 3-isopropylmalate dehydrogenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LEU2 PE=3 SV=1 19 346 5.0E-21
sp|Q9P3Y0|LEU3_ZYGBA 3-isopropylmalate dehydrogenase OS=Zygosaccharomyces bailii GN=LEU2 PE=3 SV=1 20 346 5.0E-21
sp|P87186|LEU3_CANAX 3-isopropylmalate dehydrogenase OS=Candida albicans GN=LEU2 PE=3 SV=1 19 346 7.0E-21
sp|Q5HS77|LEU3_CAMJR 3-isopropylmalate dehydrogenase OS=Campylobacter jejuni (strain RM1221) GN=leuB PE=3 SV=1 18 348 1.0E-20
sp|O14429|LEU3_CANGA 3-isopropylmalate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LEU2 PE=3 SV=2 19 346 3.0E-20
sp|P07139|LEU3_CANMA 3-isopropylmalate dehydrogenase OS=Candida maltosa GN=LEU2 PE=3 SV=1 19 348 4.0E-20
sp|P18120|LEU3_YARLI 3-isopropylmalate dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LEU2 PE=3 SV=2 102 341 8.0E-20
sp|P08791|LEU3_CYBJA 3-isopropylmalate dehydrogenase OS=Cyberlindnera jadinii GN=LEU2 PE=3 SV=1 19 346 2.0E-19
sp|Q01987|LEU3_CANBO 3-isopropylmalate dehydrogenase OS=Candida boidinii GN=LEU2 PE=3 SV=1 100 346 2.0E-19
sp|P23390|LEU3_KLULA 3-isopropylmalate dehydrogenase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LEU2 PE=3 SV=2 20 346 3.0E-19
sp|O94114|LEU3_PICST 3-isopropylmalate dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LEU2 PE=3 SV=3 19 347 6.0E-19
sp|Q7WNM3|LEU31_BORBR 3-isopropylmalate dehydrogenase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuB1 PE=3 SV=1 20 326 8.0E-19
sp|P41766|LEU3_KLUMA 3-isopropylmalate dehydrogenase OS=Kluyveromyces marxianus GN=LEU2 PE=3 SV=1 20 346 2.0E-18
sp|O59930|LEU3_PHACH 3-isopropylmalate dehydrogenase OS=Phanerochaete chrysosporium GN=LEU2 PE=2 SV=1 18 352 2.0E-18
sp|P50214|IDH_NOSS1 Isocitrate dehydrogenase [NADP] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=icd PE=3 SV=1 154 333 1.0E-17
sp|Q8NKB8|LEU3_BLAAD 3-isopropylmalate dehydrogenase OS=Blastobotrys adeninivorans GN=LEU2 PE=3 SV=1 20 346 9.0E-17
sp|Q3Z896|LEU3_DEHM1 3-isopropylmalate dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=leuB PE=3 SV=1 18 305 1.0E-16
sp|P80046|IDH_SYNY3 Isocitrate dehydrogenase [NADP] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=icd PE=1 SV=2 188 333 4.0E-15
sp|P50214|IDH_NOSS1 Isocitrate dehydrogenase [NADP] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=icd PE=3 SV=1 20 207 1.0E-12
sp|P80046|IDH_SYNY3 Isocitrate dehydrogenase [NADP] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=icd PE=1 SV=2 9 207 1.0E-11
sp|Q9AQC8|LEU3_BUCUL 3-isopropylmalate dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuB PE=3 SV=1 232 348 8.0E-11
sp|P86225|IDH3A_MESAU Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragments) OS=Mesocricetus auratus GN=IDH3A PE=1 SV=1 39 141 7.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5990
MATVQSDIFQPAKYGGKYTVTLIPGDGIGAEVAESVKTVFKADNVPVEWEQVAVSGLDAGGGRAEEAFRESVASL
KRNKLGLKGILHTPISRSGHQSFNVAMRQELDMYASISLIKNIPGYSTRHRDVDLCIIRENTEGEYSGLEHQSVP
GVVESLKIITRAKSERIAKFACAFALANGRSKVTCIHKANIMKLADGLFRSTFHAVAKEYPTLEVNDMIVDNASM
QAVSRPQQFDVMVMPNLYGGILSNIGAALVGGPGIVPGCNMGRDIAVFEPGCRHVGLDIKGKDQANPTAMILSGS
MLLRHLGLDDHANRISRAIYAVIAEGKVRTRDMGGNSTTHEFTKAILDKMEAD*
Coding >Ophun1|5990
ATGGCGACGGTGCAATCGGACATCTTCCAGCCAGCCAAGTACGGCGGCAAATACACGGTGACGCTGATCCCCGGT
GACGGCATCGGCGCCGAGGTAGCCGAGTCTGTCAAGACGGTCTTCAAGGCGGATAACGTGCCGGTCGAGTGGGAG
CAGGTTGCTGTCTCGGGCCTGGACGCGGGAGGCGGACGGGCCGAGGAGGCCTTTCGCGAGAGCGTGGCGTCGCTT
AAGCGCAACAAGCTGGGGCTCAAGGGGATCCTGCACACGCCCATCAGTCGTTCGGGACATCAGAGCTTCAACGTT
GCCATGCGGCAGGAGCTCGACATGTATGCCAGCATCAGCCTCATCAAGAATATCCCTGGCTACTCTACGCGACAC
CGCGACGTCGACTTGTGCATCATCCGCGAGAATACAGAGGGCGAATACTCTGGACTCGAGCACCAGAGCGTACCG
GGCGTCGTCGAATCGCTCAAGATTATCACGAGGGCCAAGTCGGAGCGCATCGCAAAGTTCGCTTGTGCCTTTGCG
CTGGCCAACGGTCGGTCCAAGGTGACGTGCATTCACAAGGCCAACATCATGAAGCTGGCGGATGGGCTCTTCCGC
AGCACTTTCCACGCCGTTGCCAAGGAGTATCCCACTCTCGAGGTCAACGACATGATTGTCGACAACGCGTCCATG
CAGGCCGTGTCGCGGCCCCAGCAGTTTGACGTCATGGTCATGCCTAACCTCTACGGCGGCATCTTGTCGAATATC
GGTGCGGCTCTTGTTGGTGGGCCTGGCATCGTGCCTGGGTGCAATATGGGACGCGATATCGCAGTGTTTGAGCCG
GGTTGTCGTCACGTCGGGCTTGATATCAAGGGAAAGGATCAGGCGAATCCTACGGCCATGATTCTGTCGGGGAGC
ATGCTGCTTCGTCACTTGGGATTGGACGACCATGCGAACCGTATCTCGCGCGCCATCTACGCTGTCATTGCCGAG
GGCAAGGTGCGCACCCGCGACATGGGCGGCAACTCGACCACGCACGAGTTCACAAAGGCCATCCTCGACAAGATG
GAAGCTGACTGA
Transcript >Ophun1|5990
ATGGCGACGGTGCAATCGGACATCTTCCAGCCAGCCAAGTACGGCGGCAAATACACGGTGACGCTGATCCCCGGT
GACGGCATCGGCGCCGAGGTAGCCGAGTCTGTCAAGACGGTCTTCAAGGCGGATAACGTGCCGGTCGAGTGGGAG
CAGGTTGCTGTCTCGGGCCTGGACGCGGGAGGCGGACGGGCCGAGGAGGCCTTTCGCGAGAGCGTGGCGTCGCTT
AAGCGCAACAAGCTGGGGCTCAAGGGGATCCTGCACACGCCCATCAGTCGTTCGGGACATCAGAGCTTCAACGTT
GCCATGCGGCAGGAGCTCGACATGTATGCCAGCATCAGCCTCATCAAGAATATCCCTGGCTACTCTACGCGACAC
CGCGACGTCGACTTGTGCATCATCCGCGAGAATACAGAGGGCGAATACTCTGGACTCGAGCACCAGAGCGTACCG
GGCGTCGTCGAATCGCTCAAGATTATCACGAGGGCCAAGTCGGAGCGCATCGCAAAGTTCGCTTGTGCCTTTGCG
CTGGCCAACGGTCGGTCCAAGGTGACGTGCATTCACAAGGCCAACATCATGAAGCTGGCGGATGGGCTCTTCCGC
AGCACTTTCCACGCCGTTGCCAAGGAGTATCCCACTCTCGAGGTCAACGACATGATTGTCGACAACGCGTCCATG
CAGGCCGTGTCGCGGCCCCAGCAGTTTGACGTCATGGTCATGCCTAACCTCTACGGCGGCATCTTGTCGAATATC
GGTGCGGCTCTTGTTGGTGGGCCTGGCATCGTGCCTGGGTGCAATATGGGACGCGATATCGCAGTGTTTGAGCCG
GGTTGTCGTCACGTCGGGCTTGATATCAAGGGAAAGGATCAGGCGAATCCTACGGCCATGATTCTGTCGGGGAGC
ATGCTGCTTCGTCACTTGGGATTGGACGACCATGCGAACCGTATCTCGCGCGCCATCTACGCTGTCATTGCCGAG
GGCAAGGTGCGCACCCGCGACATGGGCGGCAACTCGACCACGCACGAGTTCACAAAGGCCATCCTCGACAAGATG
GAAGCTGACTGA
Gene >Ophun1|5990
ATGGCGACGGTGCAATCGGACATCTTCCAGCCAGCCAAGTACGGCGGCAAATACACGGTGACGCTGATCCCCGGT
GACGGCATCGGCGCCGAGGTAGCCGAGTCTGTCAAGACGGTCTTCAAGGCGGATAACGTGCCGGTCGAGTGGGAG
CAGGTTGCTGTCTCGGGCCTGGACGCGGGAGGCGGACGGGCCGAGGAGGCCTTTCGCGAGAGCGTGGCGTCGCTT
AAGCGCAACAAGCTGGGGCTCAAGGGGATCCTGCACACGCCCATCAGTCGTTCGGGACATCAGAGCTTCAACGTT
GCCATGCGGCAGGAGCTCGACATGTATGCCAGCATCAGCCTCATCAAGAATATCCCTGGCTACTCTACGCGACAC
CGCGACGTCGACTTGTGCATCATCCGCGAGAATACAGAGGGCGAATACTCTGGACTCGAGCACCAGAGCGTACCG
GGCGTCGTCGAATCGCTCAAGATTATCACGAGGGCCAAGTCGGAGCGCATCGCAAAGTTCGCTTGTGCCTTTGCG
CTGGCCAACGGTCGGTCCAAGGTGACGTGCATTCACAAGGCCAACATCATGAAGCTGGCGGATGGGCTCTTCCGC
AGCACTTTCCACGCCGTTGCCAAGGAGTATCCCACTCTCGAGGTCAACGACATGATTGTCGACAACGCGTCCATG
CAGGCCGTGTCGCGGCCCCAGCAGTTTGACGTCATGGTCATGCCTAACCTCTACGGCGGCATCTTGTCGAATATC
GGTGCGGCTCTTGTTGGTGGGCCTGGCATCGTGCCTGGGTGCAATATGGGACGCGATATCGCAGTGTTTGAGCCG
GGTTGTCGTCACGTCGGGCTTGATATCAAGGGAAAGGATCAGGCGAATCCTACGGCCATGATTCTGTCGGGGAGC
ATGCTGCTTCGTCACTTGGGATTGGACGACCATGCGAACCGTATCTCGCGCGCCATCTACGCTGTCATTGCCGAG
GGGTGAGATAGCATCTTGTGTCGATTTTGTACAAAGTGGCTGACTTGAAGCAGCAAGGTGCGCACCCGCGACATG
GGCGGCAACTCGACCACGCACGAGTTCACAAAGGCCATCCTCGACAAGATGGAAGCTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail