Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5989
Gene name
LocationContig_620:9003..10250
Strand-
Gene length (bp)1247
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02116 STE2 Fungal pheromone mating factor STE2 GPCR 2.0E-74 20 303

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016020 membrane Yes
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0060089 molecular transducer activity No
GO:0009987 cellular process No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0007165 signal transduction No
GO:0016503 pheromone receptor activity No
GO:0004888 transmembrane signaling receptor activity No
GO:0001653 peptide receptor activity No
GO:0004930 G protein-coupled receptor activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0038023 signaling receptor activity No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 92 114 22
3 129 151 22
4 171 193 22
5 208 230 22
6 251 273 22
7 283 302 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5989
MKPSEASYLSGFPSKPEPGFDPADQMLAFYARDGQTVIGVPMTTIDDFNAESISMGITSGAEIGACLIILAAIIV
LTPLDKLRRPTAVFQMVALFLCLARAAFEISDLFTPIFHFYIYWAGDYTGVPRGYIYRGIAGHVVTMLVNMAVEL
TLMNQAWTMVSLFSATPRLWLTLVSALVALVVVGLRITFAVMLSQVDVVSAPRSSLDWIMQATLISNTISIFWFC
ALFNSKLVLHIIANRGILSSSGRKLSSMEVLVMTNGVLMVIPVIFAGLEYGNFRNFEPARLTIATVAVILPLGTL
AAQRINTPTSSKVSEREADSSNSKQSGTAFSNLRKQSMSSSSASPFSKCERGRGSVRAGATRVEDPYDLELRRID
TTGLSGILIDQKLEQRYESV*
Coding >Ophun1|5989
ATGAAGCCATCCGAAGCTTCCTACCTCAGCGGATTCCCTTCCAAGCCCGAGCCAGGCTTCGACCCGGCAGACCAG
ATGCTGGCCTTTTACGCCCGCGACGGTCAGACGGTCATCGGCGTGCCCATGACCACCATCGACGACTTTAACGCC
GAGTCCATAAGCATGGGCATCACCAGCGGCGCCGAAATAGGAGCCTGCCTCATCATTCTCGCCGCCATCATCGTC
CTCACGCCTCTTGACAAGCTGCGACGCCCGACGGCCGTGTTCCAGATGGTGGCTCTCTTCCTGTGCCTTGCCCGT
GCCGCCTTTGAGATTTCAGACCTGTTCACGCCCATCTTTCACTTTTACATCTATTGGGCTGGCGATTATACCGGT
GTGCCGCGCGGATACATCTACAGGGGCATCGCCGGCCACGTCGTCACCATGCTCGTCAACATGGCCGTCGAGTTG
ACGCTGATGAACCAGGCCTGGACCATGGTTTCGCTCTTTTCTGCCACGCCGAGGCTGTGGTTGACGCTCGTCTCT
GCCCTCGTCGCCTTGGTTGTTGTCGGGTTGCGCATCACTTTCGCCGTCATGCTGAGCCAAGTCGATGTCGTGTCT
GCTCCGCGGTCGTCCTTGGACTGGATAATGCAGGCTACGCTCATCTCCAACACCATTTCCATCTTCTGGTTTTGC
GCCCTGTTCAACTCCAAGCTAGTTCTTCACATCATCGCCAACCGTGGAATTCTGTCGTCGTCGGGCCGAAAGCTG
AGCTCCATGGAGGTTCTCGTCATGACCAATGGTGTCCTCATGGTTATCCCAGTCATCTTCGCTGGTCTCGAATAC
GGTAACTTTCGCAACTTCGAACCAGCCCGACTGACGATAGCCACCGTCGCCGTCATCCTCCCCCTGGGAACTCTC
GCCGCCCAGCGAATCAACACGCCAACCAGCAGCAAAGTCTCAGAACGCGAAGCCGATTCATCCAACAGCAAACAG
TCCGGCACCGCCTTCTCCAACCTCAGAAAGCAGAGCATGTCCAGCAGCTCGGCATCGCCCTTTTCCAAGTGCGAG
CGCGGTCGGGGCAGTGTCCGTGCCGGCGCAACGCGTGTCGAGGATCCCTATGATCTAGAGCTTCGCCGCATTGAT
ACTACAGGTTTATCCGGCATTCTCATCGACCAGAAGCTCGAGCAGCGGTACGAGAGCGTCTAG
Transcript >Ophun1|5989
ATGAAGCCATCCGAAGCTTCCTACCTCAGCGGATTCCCTTCCAAGCCCGAGCCAGGCTTCGACCCGGCAGACCAG
ATGCTGGCCTTTTACGCCCGCGACGGTCAGACGGTCATCGGCGTGCCCATGACCACCATCGACGACTTTAACGCC
GAGTCCATAAGCATGGGCATCACCAGCGGCGCCGAAATAGGAGCCTGCCTCATCATTCTCGCCGCCATCATCGTC
CTCACGCCTCTTGACAAGCTGCGACGCCCGACGGCCGTGTTCCAGATGGTGGCTCTCTTCCTGTGCCTTGCCCGT
GCCGCCTTTGAGATTTCAGACCTGTTCACGCCCATCTTTCACTTTTACATCTATTGGGCTGGCGATTATACCGGT
GTGCCGCGCGGATACATCTACAGGGGCATCGCCGGCCACGTCGTCACCATGCTCGTCAACATGGCCGTCGAGTTG
ACGCTGATGAACCAGGCCTGGACCATGGTTTCGCTCTTTTCTGCCACGCCGAGGCTGTGGTTGACGCTCGTCTCT
GCCCTCGTCGCCTTGGTTGTTGTCGGGTTGCGCATCACTTTCGCCGTCATGCTGAGCCAAGTCGATGTCGTGTCT
GCTCCGCGGTCGTCCTTGGACTGGATAATGCAGGCTACGCTCATCTCCAACACCATTTCCATCTTCTGGTTTTGC
GCCCTGTTCAACTCCAAGCTAGTTCTTCACATCATCGCCAACCGTGGAATTCTGTCGTCGTCGGGCCGAAAGCTG
AGCTCCATGGAGGTTCTCGTCATGACCAATGGTGTCCTCATGGTTATCCCAGTCATCTTCGCTGGTCTCGAATAC
GGTAACTTTCGCAACTTCGAACCAGCCCGACTGACGATAGCCACCGTCGCCGTCATCCTCCCCCTGGGAACTCTC
GCCGCCCAGCGAATCAACACGCCAACCAGCAGCAAAGTCTCAGAACGCGAAGCCGATTCATCCAACAGCAAACAG
TCCGGCACCGCCTTCTCCAACCTCAGAAAGCAGAGCATGTCCAGCAGCTCGGCATCGCCCTTTTCCAAGTGCGAG
CGCGGTCGGGGCAGTGTCCGTGCCGGCGCAACGCGTGTCGAGGATCCCTATGATCTAGAGCTTCGCCGCATTGAT
ACTACAGGTTTATCCGGCATTCTCATCGACCAGAAGCTCGAGCAGCGGTACGAGAGCGTCTAG
Gene >Ophun1|5989
ATGAAGCCATCCGAAGCTTCCTACCTCAGCGGATTCCCTTCCAAGCCCGAGCCAGGCTTCGACCCGGCAGACCAG
ATGCTGGCCTTTTACGCCCGCGACGGTCAGACGGTCATCGGCGTGCCCATGACCACCATCGACGACTTTAACGCC
GAGTCCATAAGCATGGGCATCACCAGCGGCGCCGAAATAGGAGCCTGCCTCATCATTCTCGCCGCCATCATCGTC
CTCACGCCTCTTGACAAGCTGCGACGCCCGACGGCCGTGTTCCAGATGGTGGCTCTCTTCCTGTGCCTTGCCCGT
GCCGCCTTTGAGATTTCAGACCTGTTCACGCCCATCTTTCACTTTTACATCTATTGGGCTGGCGATTATACCGGT
GTGCCGCGCGGATACATCTACAGGGGCATCGCCGGCCACGTCGTCACCATGCTCGTCAACATGGCCGTCGAGTTG
ACGCTGATGAACCAGGCCTGGACCATGGTTTCGCTCTTTTCTGCCACGCCGAGGCTGTGGTTGACGCTCGTCTCT
GCCCTCGTCGCCTTGGTTGTTGTCGGGTTGCGCATCACTTTCGCCGTCATGCTGAGCCAAGTCGATGTCGTGTCT
GCTCCGCGGTCGTCCTTGGACTGGATAATGCAGGCTACGCTCATCTCCAACACCATTTCCATCTTCTGGTTTTGC
GCCCTGTTCAACTCCAAGCTAGTTCTTCACATCATCGCCAACCGTGGAATTCTGTCGTCGTCGGGCCGAAAGCTG
AGCTCCATGGAGGTTCTCGTCATGACCAATGGTGTCCTCATGGTTATCCCAGGTAAATACCGCTCCCATTTTGAT
ATCCCGTTGAAATCAATTTACTTATGAATGTCTCAGTCATCTTCGCTGGTCTCGAATACGGTAACTTTCGCAACT
TCGAACCAGCCCGACTGACGATAGCCACCGTCGCCGTCATCCTCCCCCTGGGAACTCTCGCCGCCCAGCGAATCA
ACACGCCAACCAGCAGCAAAGTCTCAGAACGCGAAGCCGATTCATCCAACAGCAAACAGTCCGGCACCGCCTTCT
CCAACCTCAGAAAGCAGAGCATGTCCAGCAGCTCGGCATCGCCCTTTTCCAAGTGCGAGCGCGGTCGGGGCAGTG
TCCGTGCCGGCGCAACGCGTGTCGAGGATCCCTATGATCTAGAGCTTCGCCGCATTGATACTACAGGTTTATCCG
GCATTCTCATCGACCAGAAGCTCGAGCAGCGGTACGAGAGCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail