Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5980
Gene name
LocationContig_62:34791..37060
Strand-
Gene length (bp)2269
Transcript length (bp)2166
Coding sequence length (bp)2166
Protein length (aa) 722

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08172 CASP_C CASP C terminal 6.1E-92 436 680

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34237|CASP_YEAST Protein CASP OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COY1 PE=1 SV=2 31 711 3.0E-71
sp|O59795|CASP_SCHPO Protein CASP OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coy1 PE=3 SV=1 31 678 1.0E-67
sp|Q5R8V1|CASP_PONAB Protein CASP OS=Pongo abelii GN=CUTL1 PE=2 SV=1 25 695 3.0E-53
sp|Q13948|CASP_HUMAN Protein CASP OS=Homo sapiens GN=CUX1 PE=1 SV=2 25 695 7.0E-53
sp|P70403|CASP_MOUSE Protein CASP OS=Mus musculus GN=Cux1 PE=1 SV=2 38 681 7.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34237|CASP_YEAST Protein CASP OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COY1 PE=1 SV=2 31 711 3.0E-71
sp|O59795|CASP_SCHPO Protein CASP OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coy1 PE=3 SV=1 31 678 1.0E-67
sp|Q5R8V1|CASP_PONAB Protein CASP OS=Pongo abelii GN=CUTL1 PE=2 SV=1 25 695 3.0E-53
sp|Q13948|CASP_HUMAN Protein CASP OS=Homo sapiens GN=CUX1 PE=1 SV=2 25 695 7.0E-53
sp|P70403|CASP_MOUSE Protein CASP OS=Mus musculus GN=Cux1 PE=1 SV=2 38 681 7.0E-52
sp|Q9LS42|CASP_ARATH Protein CASP OS=Arabidopsis thaliana GN=CASP PE=1 SV=2 38 687 3.0E-39
sp|P53565|CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus GN=Cux1 PE=1 SV=2 25 430 2.0E-24
sp|P39880|CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens GN=CUX1 PE=1 SV=3 46 430 2.0E-21
sp|P53564|CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus GN=Cux1 PE=1 SV=3 46 430 4.0E-21
sp|Q8IA98|CASP_CAEEL Protein CASP OS=Caenorhabditis elegans GN=ceh-44 PE=3 SV=1 37 675 3.0E-20
sp|O14529|CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens GN=CUX2 PE=1 SV=4 28 385 3.0E-11
sp|Q9BL02|CUT_CAEEL Homeobox protein cut-like ceh-44 OS=Caenorhabditis elegans GN=ceh-44 PE=3 SV=1 37 427 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0030173 integral component of Golgi membrane Yes
GO:0006891 intra-Golgi vesicle-mediated transport Yes
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0031228 intrinsic component of Golgi membrane No
GO:0016021 integral component of membrane No
GO:0051234 establishment of localization No
GO:0048193 Golgi vesicle transport No
GO:0031300 intrinsic component of organelle membrane No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0031301 integral component of organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 658 680 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5980
MADAAQAPAPAPAAFAVTEPASNPAEGGNKFQDAISAWRNVDLTTLTANLDNTASEIVTYQRDSTVQRKDLAQKT
KEFRKLDDAAKLVEVKGLLKAYQTFIDLLTTHSKSVNSAFLQTYSSISEAPDPYPLLEAAVDSMLVTEETLPRVT
EENQRLQENVARLTSQLGEAESMLQVERAARKESEDTLETRVKGVESSWTAVLDEKKDNWEARERSLEEKLENQE
RLLSEMRASYEVGQRLGLSGEDADASRGNASSAELEMLHTELEQKGARLAEVEARNEQMRLELAQAKSSMSSQPE
RPLEDDPDFMRMRTENSSLIRKLEAARMDKEKLKRDLDTRLHSMEREASLLKEERALLKSKMQKWSDYDDIKQEL
EVLKSIEFSTGDDDEAGDKADDGAEKGDTLEKLLLSRNKKLSEELTILRVSHQDLDKRLASIQEELSGTKEEFEK
AQKLNEKLESDLANMQTEGASAFPSGASVAGTYVTRAPTRKGKISPTSSIISGMDPRMSQEPMGGGSGILPMVTA
QRDRFKKKNAQLEQDLGEAHKTVRQLRQEVAALQKDNLNLYEKTRYVSTYNRGGATASAYATNPNPSTVSIGGTG
NPGISLDRYRKAYESNLSPFAAFRGRESARAYGRMSFPERVVYSITRMVLASRASRNLFAAYCVALHVLVFLSLY
WLGSSDLEKHGSNFGSSAAAAVSRDGPLAGGGAEHGKWREEGFNGQ*
Coding >Ophun1|5980
ATGGCCGACGCCGCTCAAGCGCCTGCGCCTGCGCCAGCTGCATTCGCAGTTACGGAGCCGGCTTCAAACCCAGCT
GAAGGGGGCAACAAGTTCCAAGATGCCATCTCGGCATGGCGGAATGTCGACCTCACGACGTTGACGGCGAATCTC
GATAACACGGCGTCGGAGATTGTGACTTATCAACGAGACTCGACCGTCCAGCGCAAGGATCTCGCGCAAAAGACA
AAGGAGTTTCGGAAGCTGGACGACGCTGCCAAGTTGGTAGAAGTCAAGGGTCTTCTCAAAGCCTACCAAACATTC
ATTGATCTCCTCACTACCCACTCCAAATCTGTCAACTCTGCCTTTCTCCAAACATACAGCTCCATATCCGAAGCG
CCCGATCCGTATCCGCTCTTAGAGGCCGCTGTCGACTCCATGCTCGTGACGGAGGAGACGCTCCCAAGGGTTACA
GAAGAGAACCAGCGGCTCCAAGAAAATGTGGCCAGGCTGACGTCCCAGCTAGGAGAGGCCGAATCCATGCTGCAA
GTCGAACGAGCCGCGCGCAAAGAGTCGGAAGACACACTCGAGACCAGGGTCAAGGGCGTGGAATCGTCATGGACC
GCCGTTTTGGATGAGAAGAAAGACAACTGGGAAGCTCGGGAGAGGAGTCTAGAAGAAAAGTTGGAAAATCAGGAG
CGCCTTCTCAGCGAGATGCGTGCGAGTTACGAGGTCGGCCAGCGGCTCGGTCTGAGCGGAGAAGACGCGGACGCT
TCGCGCGGCAACGCTTCGAGCGCCGAGCTGGAGATGCTGCACACGGAGCTTGAGCAGAAAGGTGCCAGACTGGCC
GAGGTAGAAGCACGGAACGAACAGATGAGGCTGGAGCTGGCTCAGGCCAAGTCTTCCATGTCCTCCCAGCCTGAG
AGACCTCTCGAGGACGACCCGGACTTTATGCGGATGCGGACCGAGAACTCGTCACTGATTCGCAAGCTCGAGGCT
GCCAGGATGGACAAGGAAAAACTGAAACGCGATCTCGACACGCGGTTGCATTCGATGGAGCGGGAGGCGTCGCTG
TTAAAGGAGGAGAGGGCTCTGCTCAAGTCCAAGATGCAGAAATGGAGTGATTACGACGATATCAAGCAAGAGTTG
GAAGTTCTCAAAAGCATAGAGTTTTCTACCGGCGACGACGATGAAGCCGGTGACAAGGCGGACGACGGCGCGGAG
AAGGGCGACACTCTGGAAAAGCTCCTGCTGTCGCGAAACAAGAAGCTTAGCGAGGAGCTCACCATTCTCCGGGTC
TCCCATCAAGATCTCGACAAGAGGCTGGCGAGTATTCAGGAAGAGCTATCAGGGACCAAGGAAGAGTTCGAGAAG
GCGCAGAAGCTCAACGAGAAGCTGGAGAGTGATCTGGCCAACATGCAGACTGAAGGAGCGAGCGCTTTTCCGTCG
GGAGCGTCTGTGGCCGGGACGTACGTGACGCGTGCGCCTACTCGAAAGGGCAAGATATCGCCGACGTCGTCCATC
ATCAGCGGCATGGACCCGCGGATGTCGCAGGAGCCGATGGGCGGCGGATCCGGTATCCTACCCATGGTCACGGCA
CAACGAGACCGGTTCAAGAAGAAGAATGCGCAGCTGGAGCAGGACTTGGGCGAGGCGCACAAGACCGTCCGCCAG
CTGCGACAGGAAGTGGCAGCGCTTCAAAAGGACAACTTGAACCTATACGAGAAGACGCGTTACGTGTCGACGTAT
AACCGGGGCGGCGCGACAGCTTCAGCATACGCGACGAACCCGAACCCGTCGACGGTCTCAATCGGAGGGACGGGC
AACCCGGGCATCTCACTGGACCGGTACCGCAAGGCGTACGAGTCCAACCTGTCGCCCTTTGCGGCTTTCCGGGGC
CGCGAGTCGGCCAGAGCGTACGGACGGATGAGCTTCCCGGAGAGGGTCGTGTACTCGATCACGAGGATGGTGCTG
GCGTCACGGGCTAGCAGGAACCTGTTTGCGGCCTACTGCGTCGCGCTGCACGTCCTGGTCTTCCTGTCGCTGTAC
TGGCTTGGGAGCTCGGACCTGGAGAAGCACGGGAGCAATTTTGGATCATCGGCGGCGGCGGCGGTCAGCCGGGAC
GGACCTTTGGCGGGAGGCGGCGCGGAGCACGGGAAATGGCGAGAGGAAGGCTTCAACGGACAGTGA
Transcript >Ophun1|5980
ATGGCCGACGCCGCTCAAGCGCCTGCGCCTGCGCCAGCTGCATTCGCAGTTACGGAGCCGGCTTCAAACCCAGCT
GAAGGGGGCAACAAGTTCCAAGATGCCATCTCGGCATGGCGGAATGTCGACCTCACGACGTTGACGGCGAATCTC
GATAACACGGCGTCGGAGATTGTGACTTATCAACGAGACTCGACCGTCCAGCGCAAGGATCTCGCGCAAAAGACA
AAGGAGTTTCGGAAGCTGGACGACGCTGCCAAGTTGGTAGAAGTCAAGGGTCTTCTCAAAGCCTACCAAACATTC
ATTGATCTCCTCACTACCCACTCCAAATCTGTCAACTCTGCCTTTCTCCAAACATACAGCTCCATATCCGAAGCG
CCCGATCCGTATCCGCTCTTAGAGGCCGCTGTCGACTCCATGCTCGTGACGGAGGAGACGCTCCCAAGGGTTACA
GAAGAGAACCAGCGGCTCCAAGAAAATGTGGCCAGGCTGACGTCCCAGCTAGGAGAGGCCGAATCCATGCTGCAA
GTCGAACGAGCCGCGCGCAAAGAGTCGGAAGACACACTCGAGACCAGGGTCAAGGGCGTGGAATCGTCATGGACC
GCCGTTTTGGATGAGAAGAAAGACAACTGGGAAGCTCGGGAGAGGAGTCTAGAAGAAAAGTTGGAAAATCAGGAG
CGCCTTCTCAGCGAGATGCGTGCGAGTTACGAGGTCGGCCAGCGGCTCGGTCTGAGCGGAGAAGACGCGGACGCT
TCGCGCGGCAACGCTTCGAGCGCCGAGCTGGAGATGCTGCACACGGAGCTTGAGCAGAAAGGTGCCAGACTGGCC
GAGGTAGAAGCACGGAACGAACAGATGAGGCTGGAGCTGGCTCAGGCCAAGTCTTCCATGTCCTCCCAGCCTGAG
AGACCTCTCGAGGACGACCCGGACTTTATGCGGATGCGGACCGAGAACTCGTCACTGATTCGCAAGCTCGAGGCT
GCCAGGATGGACAAGGAAAAACTGAAACGCGATCTCGACACGCGGTTGCATTCGATGGAGCGGGAGGCGTCGCTG
TTAAAGGAGGAGAGGGCTCTGCTCAAGTCCAAGATGCAGAAATGGAGTGATTACGACGATATCAAGCAAGAGTTG
GAAGTTCTCAAAAGCATAGAGTTTTCTACCGGCGACGACGATGAAGCCGGTGACAAGGCGGACGACGGCGCGGAG
AAGGGCGACACTCTGGAAAAGCTCCTGCTGTCGCGAAACAAGAAGCTTAGCGAGGAGCTCACCATTCTCCGGGTC
TCCCATCAAGATCTCGACAAGAGGCTGGCGAGTATTCAGGAAGAGCTATCAGGGACCAAGGAAGAGTTCGAGAAG
GCGCAGAAGCTCAACGAGAAGCTGGAGAGTGATCTGGCCAACATGCAGACTGAAGGAGCGAGCGCTTTTCCGTCG
GGAGCGTCTGTGGCCGGGACGTACGTGACGCGTGCGCCTACTCGAAAGGGCAAGATATCGCCGACGTCGTCCATC
ATCAGCGGCATGGACCCGCGGATGTCGCAGGAGCCGATGGGCGGCGGATCCGGTATCCTACCCATGGTCACGGCA
CAACGAGACCGGTTCAAGAAGAAGAATGCGCAGCTGGAGCAGGACTTGGGCGAGGCGCACAAGACCGTCCGCCAG
CTGCGACAGGAAGTGGCAGCGCTTCAAAAGGACAACTTGAACCTATACGAGAAGACGCGTTACGTGTCGACGTAT
AACCGGGGCGGCGCGACAGCTTCAGCATACGCGACGAACCCGAACCCGTCGACGGTCTCAATCGGAGGGACGGGC
AACCCGGGCATCTCACTGGACCGGTACCGCAAGGCGTACGAGTCCAACCTGTCGCCCTTTGCGGCTTTCCGGGGC
CGCGAGTCGGCCAGAGCGTACGGACGGATGAGCTTCCCGGAGAGGGTCGTGTACTCGATCACGAGGATGGTGCTG
GCGTCACGGGCTAGCAGGAACCTGTTTGCGGCCTACTGCGTCGCGCTGCACGTCCTGGTCTTCCTGTCGCTGTAC
TGGCTTGGGAGCTCGGACCTGGAGAAGCACGGGAGCAATTTTGGATCATCGGCGGCGGCGGCGGTCAGCCGGGAC
GGACCTTTGGCGGGAGGCGGCGCGGAGCACGGGAAATGGCGAGAGGAAGGCTTCAACGGACAGTGA
Gene >Ophun1|5980
ATGGCCGACGCCGCTCAAGCGCCTGCGCCTGCGCCAGCTGCATTCGCAGTTACGGAGCCGGCTTCAAACCCAGCT
GAAGGGGGCAACAAGTTCCAAGATGCCATCTCGGCATGGCGGAGTACGCTCTAATCAGCGATCATGTTTGCATAT
TTACTGACGCAGTAGGCTACAGATGTCGACCTCACGACGTTGACGGCGAATCTCGATAACACGGCGTCGGAGATT
GTGACTTATCAACGAGACTCGACCGTCCAGCGCAAGGATCTCGCGCAAAAGACAAAGGAGTTTCGGAAGCTGGAC
GACGCTGCCAAGTTGGTAGAAGTCAAGGGTCTTCTCAAAGGTATCGTCTCCGAACGAGGCGGTGGAAGACTTGGC
TAACCTGCCGACAGCCTACCAAACATTCATTGATCTCCTCACTACCCACTCCAAATCTGTCAACTCTGCCTTTCT
CCAAACATACAGCTCCATATCCGAAGCGCCCGATCCGTATCCGCTCTTAGAGGCCGCTGTCGACTCCATGCTCGT
GACGGAGGAGACGCTCCCAAGGGTTACAGAAGAGAACCAGCGGCTCCAAGAAAATGTGGCCAGGCTGACGTCCCA
GCTAGGAGAGGCCGAATCCATGCTGCAAGTCGAACGAGCCGCGCGCAAAGAGTCGGAAGACACACTCGAGACCAG
GGTCAAGGGCGTGGAATCGTCATGGACCGCCGTTTTGGATGAGAAGAAAGACAACTGGGAAGCTCGGGAGAGGAG
TCTAGAAGAAAAGTTGGAAAATCAGGAGCGCCTTCTCAGCGAGATGCGTGCGAGTTACGAGGTCGGCCAGCGGCT
CGGTCTGAGCGGAGAAGACGCGGACGCTTCGCGCGGCAACGCTTCGAGCGCCGAGCTGGAGATGCTGCACACGGA
GCTTGAGCAGAAAGGTGCCAGACTGGCCGAGGTAGAAGCACGGAACGAACAGATGAGGCTGGAGCTGGCTCAGGC
CAAGTCTTCCATGTCCTCCCAGCCTGAGAGACCTCTCGAGGACGACCCGGACTTTATGCGGATGCGGACCGAGAA
CTCGTCACTGATTCGCAAGCTCGAGGCTGCCAGGATGGACAAGGAAAAACTGAAACGCGATCTCGACACGCGGTT
GCATTCGATGGAGCGGGAGGCGTCGCTGTTAAAGGAGGAGAGGGCTCTGCTCAAGTCCAAGATGCAGAAATGGAG
TGATTACGACGATATCAAGCAAGAGTTGGAAGTTCTCAAAAGCATAGAGTTTTCTACCGGCGACGACGATGAAGC
CGGTGACAAGGCGGACGACGGCGCGGAGAAGGGCGACACTCTGGAAAAGCTCCTGCTGTCGCGAAACAAGAAGCT
TAGCGAGGAGCTCACCATTCTCCGGGTCTCCCATCAAGATCTCGACAAGAGGCTGGCGAGTATTCAGGAAGAGCT
ATCAGGGACCAAGGAAGAGTTCGAGAAGGCGCAGAAGCTCAACGAGAAGCTGGAGAGTGATCTGGCCAACATGCA
GACTGAAGGAGCGAGCGCTTTTCCGTCGGGAGCGTCTGTGGCCGGGACGTACGTGACGCGTGCGCCTACTCGAAA
GGGCAAGATATCGCCGACGTCGTCCATCATCAGCGGCATGGACCCGCGGATGTCGCAGGAGCCGATGGGCGGCGG
ATCCGGTATCCTACCCATGGTCACGGCACAACGAGACCGGTTCAAGAAGAAGAATGCGCAGCTGGAGCAGGACTT
GGGCGAGGCGCACAAGACCGTCCGCCAGCTGCGACAGGAAGTGGCAGCGCTTCAAAAGGACAACTTGAACCTATA
CGAGAAGACGCGTTACGTGTCGACGTATAACCGGGGCGGCGCGACAGCTTCAGCATACGCGACGAACCCGAACCC
GTCGACGGTCTCAATCGGAGGGACGGGCAACCCGGGCATCTCACTGGACCGGTACCGCAAGGCGTACGAGTCCAA
CCTGTCGCCCTTTGCGGCTTTCCGGGGCCGCGAGTCGGCCAGAGCGTACGGACGGATGAGCTTCCCGGAGAGGGT
CGTGTACTCGATCACGAGGATGGTGCTGGCGTCACGGGCTAGCAGGAACCTGTTTGCGGCCTACTGCGTCGCGCT
GCACGTCCTGGTCTTCCTGTCGCTGTACTGGCTTGGGAGCTCGGACCTGGAGAAGCACGGGAGCAATTTTGGATC
ATCGGCGGCGGCGGCGGTCAGCCGGGACGGACCTTTGGCGGGAGGCGGCGCGGAGCACGGGAAATGGCGAGAGGA
AGGCTTCAACGGACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail