Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5976
Gene name
LocationContig_62:27203..28927
Strand+
Gene length (bp)1724
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 3.1E-40 235 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 31 516 1.0E-75
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 31 516 3.0E-74
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 61 514 2.0E-43
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 61 488 6.0E-43
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 61 514 8.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 31 516 1.0E-75
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 31 516 3.0E-74
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 61 514 2.0E-43
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 61 488 6.0E-43
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 61 514 8.0E-43
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 58 489 6.0E-34
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 315 494 4.0E-14
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 280 499 6.0E-14
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 292 515 2.0E-13
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 292 515 4.0E-13
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 315 504 5.0E-13
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 239 502 8.0E-13
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 226 515 1.0E-12
sp|Q9V4I0|CP9B1_DROME Cytochrome P450 9b1 OS=Drosophila melanogaster GN=Cyp9b1 PE=2 SV=1 281 483 1.0E-12
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 280 490 1.0E-12
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 214 504 1.0E-12
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 242 513 2.0E-12
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 249 497 3.0E-12
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 280 497 3.0E-12
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 315 483 3.0E-12
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 287 498 4.0E-12
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 310 483 4.0E-12
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 286 515 8.0E-12
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 276 498 1.0E-11
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 281 515 2.0E-11
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 239 504 2.0E-11
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 281 515 2.0E-11
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 315 485 2.0E-11
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 315 483 4.0E-11
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 210 504 4.0E-11
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 281 483 4.0E-11
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 315 494 5.0E-11
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 281 515 5.0E-11
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 311 512 6.0E-11
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 281 515 6.0E-11
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 315 502 7.0E-11
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 315 492 8.0E-11
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 272 515 9.0E-11
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 315 494 1.0E-10
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 239 494 1.0E-10
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 315 483 1.0E-10
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 272 462 2.0E-10
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 281 515 2.0E-10
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 245 489 2.0E-10
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 315 504 2.0E-10
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 315 502 2.0E-10
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 248 466 2.0E-10
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 315 502 2.0E-10
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 315 497 2.0E-10
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 281 515 3.0E-10
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 315 485 3.0E-10
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 228 515 3.0E-10
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 280 501 4.0E-10
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 315 504 4.0E-10
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 315 494 4.0E-10
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 315 494 5.0E-10
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 228 515 5.0E-10
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 315 502 5.0E-10
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 315 504 6.0E-10
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 306 485 6.0E-10
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 184 515 8.0E-10
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 324 513 9.0E-10
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 272 515 1.0E-09
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 246 492 1.0E-09
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 286 466 1.0E-09
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 304 489 1.0E-09
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 315 494 2.0E-09
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 315 494 2.0E-09
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 315 499 2.0E-09
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 248 515 2.0E-09
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 281 484 2.0E-09
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 324 483 2.0E-09
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 306 516 2.0E-09
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 244 483 2.0E-09
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 202 489 2.0E-09
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 303 490 2.0E-09
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 303 490 2.0E-09
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 311 514 3.0E-09
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 235 510 3.0E-09
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 315 483 4.0E-09
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 310 515 4.0E-09
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 239 494 4.0E-09
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 235 477 5.0E-09
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 315 494 6.0E-09
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 281 515 6.0E-09
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 238 484 7.0E-09
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 246 499 8.0E-09
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 281 516 1.0E-08
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 287 489 1.0E-08
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 308 485 1.0E-08
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 231 502 1.0E-08
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 245 497 1.0E-08
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 306 515 1.0E-08
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 315 493 2.0E-08
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 315 502 2.0E-08
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 315 504 2.0E-08
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 308 503 2.0E-08
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 306 515 2.0E-08
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 280 498 2.0E-08
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 315 494 2.0E-08
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 246 492 3.0E-08
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 235 484 3.0E-08
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 231 502 3.0E-08
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 281 500 5.0E-08
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 205 490 5.0E-08
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 315 489 5.0E-08
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 263 490 6.0E-08
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 315 488 6.0E-08
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 324 490 7.0E-08
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 183 483 8.0E-08
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 281 484 8.0E-08
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 263 503 8.0E-08
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 306 515 1.0E-07
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 303 478 1.0E-07
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 220 483 1.0E-07
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 306 515 1.0E-07
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 177 488 1.0E-07
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 247 489 1.0E-07
sp|H2DH20|C7D13_PANGI Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 240 488 1.0E-07
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 184 497 1.0E-07
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 245 489 1.0E-07
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 315 485 1.0E-07
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 276 492 2.0E-07
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 177 488 2.0E-07
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 261 485 2.0E-07
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 281 515 2.0E-07
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 280 466 2.0E-07
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 220 462 2.0E-07
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 272 466 2.0E-07
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 243 488 3.0E-07
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 281 497 3.0E-07
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 308 488 3.0E-07
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 216 497 3.0E-07
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 308 490 4.0E-07
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 311 499 4.0E-07
sp|P79304|CP193_PIG Aromatase 3 OS=Sus scrofa GN=CYP19A3 PE=2 SV=2 246 489 5.0E-07
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 177 488 5.0E-07
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 205 484 5.0E-07
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 287 489 5.0E-07
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 209 490 6.0E-07
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 255 491 6.0E-07
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 262 478 6.0E-07
sp|Q29624|CP191_PIG Aromatase 1 OS=Sus scrofa GN=CYP19A1 PE=2 SV=1 246 484 6.0E-07
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 306 504 6.0E-07
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 272 515 6.0E-07
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 304 494 6.0E-07
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 281 515 6.0E-07
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 171 511 7.0E-07
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 207 478 8.0E-07
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 223 466 8.0E-07
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 306 478 9.0E-07
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 306 483 9.0E-07
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 311 498 9.0E-07
sp|P90771|C36A1_CAEEL Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 178 466 9.0E-07
sp|G3V7X8|CP26B_RAT Cytochrome P450 26B1 OS=Rattus norvegicus GN=Cyp26b1 PE=2 SV=1 248 466 9.0E-07
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 270 482 9.0E-07
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 246 488 1.0E-06
sp|O46512|CP19A_HORSE Aromatase OS=Equus caballus GN=CYP19A1 PE=2 SV=1 286 489 1.0E-06
sp|Q7XHW5|C14B1_ORYSJ Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 311 485 1.0E-06
sp|Q1ZXF3|C5172_DICDI Probable cytochrome P450 517A2 OS=Dictyostelium discoideum GN=cyp517A2 PE=3 SV=1 249 516 1.0E-06
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 315 515 1.0E-06
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 311 485 1.0E-06
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 315 515 1.0E-06
sp|O14442|CP51_UNCNE Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 276 490 1.0E-06
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 255 491 1.0E-06
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 248 485 1.0E-06
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 308 488 2.0E-06
sp|H2DH19|C7D31_PANGI Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 244 502 2.0E-06
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 308 483 2.0E-06
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 304 481 2.0E-06
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 235 466 2.0E-06
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 306 482 2.0E-06
sp|Q54QD2|C5171_DICDI Probable cytochrome P450 517A1 OS=Dictyostelium discoideum GN=cyp517A1 PE=2 SV=1 206 512 2.0E-06
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 251 488 2.0E-06
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 324 488 2.0E-06
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 315 482 2.0E-06
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 228 483 2.0E-06
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 243 488 2.0E-06
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 255 491 2.0E-06
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 226 484 3.0E-06
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 229 490 3.0E-06
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 308 491 3.0E-06
sp|P9WPM7|CP136_MYCTU Putative cytochrome P450 136 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp136 PE=1 SV=1 254 465 3.0E-06
sp|P9WPM6|CP136_MYCTO Putative cytochrome P450 136 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp136 PE=3 SV=1 254 465 3.0E-06
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 258 482 3.0E-06
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 256 478 4.0E-06
sp|Q02315|CP51_PICKU Lanosterol 14-alpha demethylase (Fragment) OS=Pichia kudriavzevii GN=CYP51 PE=3 SV=1 292 460 4.0E-06
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 311 499 4.0E-06
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 206 462 4.0E-06
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 280 515 4.0E-06
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 281 497 4.0E-06
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 311 488 5.0E-06
sp|Q54QD0|C5174_DICDI Probable cytochrome P450 517A4 OS=Dictyostelium discoideum GN=cyp517A4 PE=3 SV=1 206 512 5.0E-06
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 252 481 5.0E-06
sp|E1BHJ4|CP26B_BOVIN Cytochrome P450 26B1 OS=Bos taurus GN=CYP26B1 PE=3 SV=1 248 466 5.0E-06
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 311 514 5.0E-06
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 280 485 5.0E-06
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 256 502 5.0E-06
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 315 475 5.0E-06
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 315 475 7.0E-06
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 256 483 7.0E-06
sp|Q9V774|C6A21_DROME Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 315 496 7.0E-06
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 245 484 8.0E-06
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 315 485 9.0E-06
sp|Q9XS28|CP19A_SHEEP Aromatase OS=Ovis aries GN=CYP19A1 PE=2 SV=1 246 488 1.0E-05
sp|Q6YI21|CP19A_CAPHI Aromatase OS=Capra hircus GN=CYP19A1 PE=2 SV=1 246 488 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 28 46 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5976
MPNISSEPVLHPALENFGPSFASRSSRLSYYIAIGVILLFAWLVQVRKRQHIISVPRFKASKIRWIFSAEKLIKE
SYLTFQDKVYQIRGTEGTQLVLPPRYVGELKILPEEVLSAKEAIQDALQSKYTKFSPGHYADLMTLLLRTRLTQN
LVKLAPQMKEELDFVMATEFPACDDWTPVKWHPFALRAVSRIGGRAFVGPDINRDERWMDTSINFAIHVFMAGAK
LQLFPEWTRPVTQYLVSDLGKIRRDIESAKELIQPVLEQRLRYLDSESGYGDAPNDMMQWLIEALPEGEKTSLQT
QVELQLVVAAASIHTTAGLLCECMYDLAAHLEVQDELRDEAREVLEGDEGWTHKDSMNKLEKMDSFMREVQRLRG
NIISFLRKVMKPISLSDGTQLPIGTRVIAPLAGIAHDERFFPNANDFDHLRFYRLRHESAKANNRMQFTALSDTY
VNFGAGRHACPGRFFAANVSKLVLARFILAYDIRLRSGEERPKPLSIVMTKSPDRDAVLEFRRREL*
Coding >Ophun1|5976
ATGCCAAACATCTCTTCGGAACCGGTCTTGCACCCTGCCTTGGAGAACTTTGGCCCGAGTTTCGCGTCGAGGAGC
TCGCGGCTGAGTTACTACATTGCCATTGGCGTCATCCTGTTGTTTGCTTGGCTGGTCCAGGTCAGAAAGCGGCAA
CACATCATATCGGTTCCTCGATTCAAGGCATCCAAAATAAGATGGATCTTTTCCGCCGAGAAATTGATCAAGGAA
AGCTATCTGACGTTCCAAGATAAGGTCTACCAGATCAGGGGCACCGAGGGCACGCAACTGGTCTTGCCGCCTCGT
TATGTCGGTGAACTCAAGATCCTGCCCGAAGAAGTATTAAGCGCCAAGGAAGCCATTCAAGATGCCCTTCAGAGC
AAATACACAAAGTTCTCGCCAGGCCACTATGCGGATCTTATGACGCTGCTGCTGCGAACTCGACTGACGCAGAAC
CTGGTCAAACTCGCACCGCAAATGAAGGAGGAGCTGGACTTTGTCATGGCCACCGAGTTTCCCGCCTGCGACGAC
TGGACGCCCGTCAAGTGGCATCCGTTTGCTCTCCGGGCTGTCAGTCGGATCGGGGGCCGGGCCTTTGTCGGACCC
GATATCAACCGCGATGAGCGGTGGATGGACACGAGCATCAACTTCGCCATTCACGTCTTCATGGCCGGCGCCAAG
CTGCAGCTGTTCCCGGAATGGACTCGGCCGGTGACGCAGTATCTCGTCTCGGACCTGGGCAAGATCCGACGCGAC
ATTGAATCGGCCAAGGAATTGATACAGCCCGTGCTTGAGCAGCGGCTGCGCTATCTGGACTCCGAGTCCGGCTAC
GGCGACGCTCCCAATGATATGATGCAATGGCTCATCGAAGCCCTTCCCGAGGGAGAAAAGACCAGCCTCCAGACG
CAGGTTGAGCTGCAGCTCGTCGTTGCCGCTGCGTCGATTCACACCACGGCTGGCCTTCTCTGCGAGTGTATGTAC
GATCTGGCCGCTCATCTGGAAGTGCAAGACGAGCTGCGGGACGAGGCTCGGGAGGTGCTTGAAGGGGACGAGGGC
TGGACGCACAAGGACAGTATGAACAAGCTGGAGAAGATGGACAGTTTCATGCGGGAGGTTCAGCGATTACGCGGG
AACATCATCTCCTTTCTCCGCAAGGTCATGAAGCCCATCAGCCTCTCAGACGGCACGCAACTCCCCATCGGCACC
CGCGTTATAGCACCCCTCGCCGGCATCGCCCACGACGAGCGCTTCTTCCCCAACGCCAACGACTTCGACCACCTA
CGCTTCTACCGCCTCCGCCACGAGTCGGCAAAGGCCAACAACCGCATGCAATTCACCGCCCTCAGCGATACCTAC
GTCAACTTCGGCGCCGGCCGCCACGCCTGCCCCGGCCGCTTCTTCGCCGCAAACGTCAGCAAGCTCGTCCTCGCC
CGCTTCATCCTCGCCTACGACATCCGTCTTCGCAGTGGCGAGGAGCGGCCGAAGCCACTGTCCATCGTCATGACC
AAGTCGCCTGATCGGGACGCTGTGCTTGAGTTTAGGCGTCGGGAGCTGTAG
Transcript >Ophun1|5976
ATGCCAAACATCTCTTCGGAACCGGTCTTGCACCCTGCCTTGGAGAACTTTGGCCCGAGTTTCGCGTCGAGGAGC
TCGCGGCTGAGTTACTACATTGCCATTGGCGTCATCCTGTTGTTTGCTTGGCTGGTCCAGGTCAGAAAGCGGCAA
CACATCATATCGGTTCCTCGATTCAAGGCATCCAAAATAAGATGGATCTTTTCCGCCGAGAAATTGATCAAGGAA
AGCTATCTGACGTTCCAAGATAAGGTCTACCAGATCAGGGGCACCGAGGGCACGCAACTGGTCTTGCCGCCTCGT
TATGTCGGTGAACTCAAGATCCTGCCCGAAGAAGTATTAAGCGCCAAGGAAGCCATTCAAGATGCCCTTCAGAGC
AAATACACAAAGTTCTCGCCAGGCCACTATGCGGATCTTATGACGCTGCTGCTGCGAACTCGACTGACGCAGAAC
CTGGTCAAACTCGCACCGCAAATGAAGGAGGAGCTGGACTTTGTCATGGCCACCGAGTTTCCCGCCTGCGACGAC
TGGACGCCCGTCAAGTGGCATCCGTTTGCTCTCCGGGCTGTCAGTCGGATCGGGGGCCGGGCCTTTGTCGGACCC
GATATCAACCGCGATGAGCGGTGGATGGACACGAGCATCAACTTCGCCATTCACGTCTTCATGGCCGGCGCCAAG
CTGCAGCTGTTCCCGGAATGGACTCGGCCGGTGACGCAGTATCTCGTCTCGGACCTGGGCAAGATCCGACGCGAC
ATTGAATCGGCCAAGGAATTGATACAGCCCGTGCTTGAGCAGCGGCTGCGCTATCTGGACTCCGAGTCCGGCTAC
GGCGACGCTCCCAATGATATGATGCAATGGCTCATCGAAGCCCTTCCCGAGGGAGAAAAGACCAGCCTCCAGACG
CAGGTTGAGCTGCAGCTCGTCGTTGCCGCTGCGTCGATTCACACCACGGCTGGCCTTCTCTGCGAGTGTATGTAC
GATCTGGCCGCTCATCTGGAAGTGCAAGACGAGCTGCGGGACGAGGCTCGGGAGGTGCTTGAAGGGGACGAGGGC
TGGACGCACAAGGACAGTATGAACAAGCTGGAGAAGATGGACAGTTTCATGCGGGAGGTTCAGCGATTACGCGGG
AACATCATCTCCTTTCTCCGCAAGGTCATGAAGCCCATCAGCCTCTCAGACGGCACGCAACTCCCCATCGGCACC
CGCGTTATAGCACCCCTCGCCGGCATCGCCCACGACGAGCGCTTCTTCCCCAACGCCAACGACTTCGACCACCTA
CGCTTCTACCGCCTCCGCCACGAGTCGGCAAAGGCCAACAACCGCATGCAATTCACCGCCCTCAGCGATACCTAC
GTCAACTTCGGCGCCGGCCGCCACGCCTGCCCCGGCCGCTTCTTCGCCGCAAACGTCAGCAAGCTCGTCCTCGCC
CGCTTCATCCTCGCCTACGACATCCGTCTTCGCAGTGGCGAGGAGCGGCCGAAGCCACTGTCCATCGTCATGACC
AAGTCGCCTGATCGGGACGCTGTGCTTGAGTTTAGGCGTCGGGAGCTGTAG
Gene >Ophun1|5976
ATGCCAAACATCTCTTCGGAACCGGTCTTGCACCCTGCCTTGGAGAACTTTGGCCCGAGTTTCGCGTCGAGGAGC
TCGCGGCTGAGTTACTACATTGCCATTGGCGTCATCCTGTTGTTTGCTTGGCTGGTCCAGGTCAGAAAGCGGCAA
CACATCATATCGGTTCCTCGATTCAAGGCATCCAAAATAAGATGGATCTTTTCCGCCGAGAAATTGATCAAGGAA
AGCTATCTGACGGTCAGCACCCCTGATGACTACCCCAAGGCCCAGCTGACGCCCGAGGCCAGTTCCAAGATAAGG
TCTACCAGATCAGGGGCACCGAGGGCACGCAACTGGTCTTGCCGCCTCGTTATGTCGGTGAACTCAAGATCCTGC
CCGAAGAAGTATTAAGCGCCAAGGAAGCCATTCAAGATGTAAATACACCGTCCCTTTCCGGATGGTCACAGTCGT
CTAACCCTCTCCTTTTCAGGCCCTTCAGAGCAAATACACAAAGTTCTCGCCAGGCCACTATGCGGATCTTATGAC
GCTGCTGCTGCGAACTCGACTGACGCAGAACCTGGTCAAACTCGCACCGCAAATGAAGGAGGAGCTGGACTTTGT
CATGGCCACCGAGTTTCCCGCCTGCGACGACTGGACGCCCGTCAAGTGGCATCCGTTTGCTCTCCGGGCTGTCAG
TCGGATCGGGGGCCGGGCCTTTGTCGGACCCGATATCAACCGCGATGAGCGGTGGATGGACACGAGCATCAACTT
CGCCATTCACGTCTTCATGGCCGGCGCCAAGCTGCAGCTGTTCCCGGAATGGACTCGGCCGGTGACGCAGTATCT
CGTCTCGGACCTGGGCAAGATCCGACGCGACATTGAATCGGCCAAGGAATTGATACAGCCCGTGCTTGAGCAGCG
GCTGCGCTATCTGGACTCCGAGTCCGGCTACGGCGACGCTCCCAATGATATGATGCAATGGCTCATCGAAGCCCT
TCCCGAGGGAGAAAAGACCAGCCTCCAGACGCAGGTTGAGCTGCAGCTCGTCGTTGCCGCTGCGTCGATTCACAC
CACGGCTGGCCTTCTCTGCGAGTGTATGTACGATCTGGCCGCTCATCTGGAAGTGCAAGACGAGCTGCGGGACGA
GGCTCGGGAGGTGCTTGAAGGGGACGAGGGCTGGACGCACAAGGACAGTATGAACAAGCTGGAGAAGATGGACAG
TTTCATGCGGGAGGTTCAGCGATTACGCGGGAACATCAGTGAGTTGAGCCGGCTTTACATCCTTTTGCACTCCTC
CCATAGCCTCCTCGAGACTAACCTCAACAGTCTCCTTTCTCCGCAAGGTCATGAAGCCCATCAGCCTCTCAGACG
GCACGCAACTCCCCATCGGCACCCGCGTTATAGCACCCCTCGCCGGCATCGCCCACGACGAGCGCTTCTTCCCCA
ACGCCAACGACTTCGACCACCTACGCTTCTACCGCCTCCGCCACGAGTCGGCAAAGGCCAACAACCGCATGCAAT
TCACCGCCCTCAGCGATACCTACGTCAACTTCGGCGCCGGCCGCCACGCCTGCCCCGGCCGCTTCTTCGCCGCAA
ACGTCAGCAAGCTCGTCCTCGCCCGCTTCATCCTCGCCTACGACATCCGTCTTCGCAGTGGCGAGGAGCGGCCGA
AGCCACTGTCCATCGTCATGACCAAGTCGCCTGATCGGGACGCTGTGCTTGAGTTTAGGCGTCGGGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail