Protein ID | Ophun1|5973 |
Gene name | |
Location | Contig_62:18560..20264 |
Strand | + |
Gene length (bp) | 1704 |
Transcript length (bp) | 1653 |
Coding sequence length (bp) | 1653 |
Protein length (aa) | 551 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF02666 | PS_Dcarbxylase | Phosphatidylserine decarboxylase | 4.9E-18 | 206 | 266 |
PF02666 | PS_Dcarbxylase | Phosphatidylserine decarboxylase | 3.7E-58 | 287 | 534 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14333|PSD1_SCHPO | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd1 PE=3 SV=4 | 47 | 536 | 3.0E-117 |
sp|P39006|PSD1_YEAST | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD1 PE=1 SV=1 | 153 | 536 | 2.0E-111 |
sp|Q9UG56|PISD_HUMAN | Phosphatidylserine decarboxylase proenzyme OS=Homo sapiens GN=PISD PE=2 SV=4 | 148 | 536 | 4.0E-73 |
sp|Q58DH2|PISD_BOVIN | Phosphatidylserine decarboxylase proenzyme OS=Bos taurus GN=PISD PE=2 SV=1 | 148 | 536 | 5.0E-73 |
sp|P27465|PISD_CRIGR | Phosphatidylserine decarboxylase proenzyme OS=Cricetulus griseus GN=PISD PE=1 SV=2 | 148 | 536 | 1.0E-72 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14333|PSD1_SCHPO | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd1 PE=3 SV=4 | 47 | 536 | 3.0E-117 |
sp|P39006|PSD1_YEAST | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD1 PE=1 SV=1 | 153 | 536 | 2.0E-111 |
sp|Q9UG56|PISD_HUMAN | Phosphatidylserine decarboxylase proenzyme OS=Homo sapiens GN=PISD PE=2 SV=4 | 148 | 536 | 4.0E-73 |
sp|Q58DH2|PISD_BOVIN | Phosphatidylserine decarboxylase proenzyme OS=Bos taurus GN=PISD PE=2 SV=1 | 148 | 536 | 5.0E-73 |
sp|P27465|PISD_CRIGR | Phosphatidylserine decarboxylase proenzyme OS=Cricetulus griseus GN=PISD PE=1 SV=2 | 148 | 536 | 1.0E-72 |
sp|Q5R8I8|PISD_PONAB | Phosphatidylserine decarboxylase proenzyme OS=Pongo abelii GN=PISD PE=2 SV=1 | 148 | 536 | 7.0E-72 |
sp|Q8BSF4|PISD_MOUSE | Phosphatidylserine decarboxylase proenzyme OS=Mus musculus GN=Pisd PE=2 SV=1 | 148 | 536 | 9.0E-72 |
sp|Q10T43|PSD1_ORYSJ | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Oryza sativa subsp. japonica GN=PSD1 PE=2 SV=1 | 148 | 535 | 6.0E-68 |
sp|Q84V22|PSD1_ARATH | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Arabidopsis thaliana GN=PSD1 PE=2 SV=1 | 148 | 538 | 9.0E-68 |
sp|Q9UTB5|PSD2_SCHPO | Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd2 PE=3 SV=1 | 341 | 533 | 4.0E-54 |
sp|Q10949|PISD_CAEEL | Phosphatidylserine decarboxylase proenzyme OS=Caenorhabditis elegans GN=psd-1 PE=3 SV=2 | 346 | 533 | 8.0E-34 |
sp|A1U4D6|PSD_MARHV | Phosphatidylserine decarboxylase proenzyme OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=psd PE=3 SV=1 | 156 | 537 | 4.0E-28 |
sp|Q0I4T3|PSD_HAES1 | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus somnus (strain 129Pt) GN=psd PE=3 SV=1 | 139 | 506 | 4.0E-27 |
sp|Q9UTB5|PSD2_SCHPO | Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd2 PE=3 SV=1 | 163 | 297 | 4.0E-25 |
sp|B0UWL4|PSD_HISS2 | Phosphatidylserine decarboxylase proenzyme OS=Histophilus somni (strain 2336) GN=psd PE=3 SV=1 | 139 | 506 | 4.0E-25 |
sp|Q3J754|PSD_NITOC | Phosphatidylserine decarboxylase proenzyme OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=psd PE=3 SV=1 | 155 | 547 | 2.0E-24 |
sp|B5F377|PSD_SALA4 | Phosphatidylserine decarboxylase proenzyme OS=Salmonella agona (strain SL483) GN=psd PE=3 SV=1 | 183 | 539 | 6.0E-23 |
sp|Q0AAC1|PSD_ALKEH | Phosphatidylserine decarboxylase proenzyme OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=psd PE=3 SV=1 | 148 | 501 | 4.0E-22 |
sp|Q65RD9|PSD_MANSM | Phosphatidylserine decarboxylase proenzyme OS=Mannheimia succiniciproducens (strain MBEL55E) GN=psd PE=3 SV=2 | 161 | 512 | 2.0E-21 |
sp|B7LC21|PSD_ECO55 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain 55989 / EAEC) GN=psd PE=3 SV=1 | 183 | 538 | 6.0E-21 |
sp|A1WV88|PSD_HALHL | Phosphatidylserine decarboxylase proenzyme OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=psd PE=3 SV=1 | 188 | 539 | 7.0E-21 |
sp|Q328E0|PSD_SHIDS | Phosphatidylserine decarboxylase proenzyme OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=psd PE=3 SV=1 | 183 | 538 | 1.0E-20 |
sp|Q2YB83|PSD_NITMU | Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 | 356 | 533 | 3.0E-20 |
sp|Q7VYM4|PSD_BORPE | Phosphatidylserine decarboxylase proenzyme OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=psd PE=3 SV=1 | 143 | 504 | 4.0E-20 |
sp|Q7W6I5|PSD_BORPA | Phosphatidylserine decarboxylase proenzyme OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=psd PE=3 SV=2 | 143 | 504 | 4.0E-20 |
sp|Q7WIF7|PSD_BORBR | Phosphatidylserine decarboxylase proenzyme OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=psd PE=3 SV=1 | 143 | 504 | 7.0E-20 |
sp|Q07XV9|PSD_SHEFN | Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 | 356 | 538 | 8.0E-20 |
sp|Q1R397|PSD_ECOUT | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=psd PE=3 SV=1 | 181 | 539 | 8.0E-20 |
sp|B7MKW7|PSD_ECO45 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=psd PE=3 SV=1 | 181 | 539 | 8.0E-20 |
sp|B7LLU4|PSD_ESCF3 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=psd PE=3 SV=1 | 181 | 539 | 1.0E-19 |
sp|B7NTL9|PSD_ECO7I | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=psd PE=3 SV=1 | 181 | 539 | 1.0E-19 |
sp|B7UPY0|PSD_ECO27 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=psd PE=3 SV=1 | 181 | 539 | 1.0E-19 |
sp|P0A8K4|PSD_SHIFL | Phosphatidylserine decarboxylase proenzyme OS=Shigella flexneri GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|Q0SXB9|PSD_SHIF8 | Phosphatidylserine decarboxylase proenzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|Q31T93|PSD_SHIBS | Phosphatidylserine decarboxylase proenzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B2TY38|PSD_SHIB3 | Phosphatidylserine decarboxylase proenzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B1LQI3|PSD_ECOSM | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B6I267|PSD_ECOSE | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain SE11) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B7NG97|PSD_ECOLU | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|P0A8K1|PSD_ECOLI | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12) GN=psd PE=1 SV=1 | 181 | 538 | 1.0E-19 |
sp|B1IT43|PSD_ECOLC | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|P0A8K2|PSD_ECOL6 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|Q0T9N1|PSD_ECOL5 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B1XDR4|PSD_ECODH | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12 / DH10B) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|C5A1F4|PSD_ECOBW | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B7M8S3|PSD_ECO8A | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O8 (strain IAI1) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B7MSX5|PSD_ECO81 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O81 (strain ED1a) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|B5Z2G9|PSD_ECO5E | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|P0A8K3|PSD_ECO57 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O157:H7 GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|A7ZV31|PSD_ECO24 | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=psd PE=3 SV=1 | 181 | 538 | 1.0E-19 |
sp|Q121P6|PSD_POLSJ | Phosphatidylserine decarboxylase proenzyme OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=psd PE=3 SV=1 | 356 | 533 | 2.0E-19 |
sp|P43789|PSD_HAEIN | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=psd PE=3 SV=1 | 164 | 534 | 3.0E-19 |
sp|Q1D614|PSD_MYXXD | Phosphatidylserine decarboxylase proenzyme OS=Myxococcus xanthus (strain DK 1622) GN=psd PE=3 SV=1 | 149 | 537 | 3.0E-19 |
sp|Q9CJU2|PSD_PASMU | Phosphatidylserine decarboxylase proenzyme OS=Pasteurella multocida (strain Pm70) GN=psd PE=3 SV=1 | 139 | 505 | 4.0E-19 |
sp|A4G529|PSD_HERAR | Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 | 356 | 550 | 4.0E-19 |
sp|Q87KZ9|PSD_VIBPA | Phosphatidylserine decarboxylase proenzyme OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=psd PE=3 SV=1 | 188 | 532 | 5.0E-19 |
sp|A4YAL8|PSD_SHEPC | Phosphatidylserine decarboxylase proenzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=psd PE=3 SV=1 | 356 | 508 | 5.0E-19 |
sp|A1RFQ8|PSD_SHESW | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain W3-18-1) GN=psd PE=3 SV=1 | 356 | 508 | 5.0E-19 |
sp|Q4QP27|PSD_HAEI8 | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus influenzae (strain 86-028NP) GN=psd PE=3 SV=1 | 164 | 534 | 5.0E-19 |
sp|Q12J86|PSD_SHEDO | Phosphatidylserine decarboxylase proenzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=psd PE=3 SV=1 | 356 | 539 | 5.0E-19 |
sp|A8H8H5|PSD_SHEPA | Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 | 356 | 538 | 5.0E-19 |
sp|Q0VMD7|PSD_ALCBS | Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 | 143 | 534 | 5.0E-19 |
sp|A3D015|PSD_SHEB5 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=psd PE=3 SV=1 | 356 | 538 | 6.0E-19 |
sp|B8ECB2|PSD_SHEB2 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS223) GN=psd PE=3 SV=1 | 356 | 538 | 6.0E-19 |
sp|A9L3W8|PSD_SHEB9 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS195) GN=psd PE=3 SV=1 | 356 | 538 | 6.0E-19 |
sp|A6WSW1|PSD_SHEB8 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS185) GN=psd PE=3 SV=1 | 356 | 538 | 6.0E-19 |
sp|Q3YUI0|PSD_SHISS | Phosphatidylserine decarboxylase proenzyme OS=Shigella sonnei (strain Ss046) GN=psd PE=3 SV=1 | 181 | 538 | 7.0E-19 |
sp|A1SA30|PSD_SHEAM | Phosphatidylserine decarboxylase proenzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=psd PE=3 SV=1 | 356 | 538 | 9.0E-19 |
sp|A9C3H8|PSD_DELAS | Phosphatidylserine decarboxylase proenzyme OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=psd PE=3 SV=1 | 355 | 539 | 9.0E-19 |
sp|A1VUQ1|PSD_POLNA | Phosphatidylserine decarboxylase proenzyme OS=Polaromonas naphthalenivorans (strain CJ2) GN=psd PE=3 SV=1 | 345 | 537 | 1.0E-18 |
sp|A3QAD1|PSD_SHELP | Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 | 356 | 537 | 1.0E-18 |
sp|B1KHV8|PSD_SHEWM | Phosphatidylserine decarboxylase proenzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=psd PE=3 SV=1 | 356 | 538 | 2.0E-18 |
sp|Q0HMP8|PSD_SHESM | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-4) GN=psd PE=3 SV=1 | 356 | 543 | 2.0E-18 |
sp|Q3IFN3|PSD_PSEHT | Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=psd PE=3 SV=2 | 356 | 502 | 3.0E-18 |
sp|C5CU16|PSD_VARPS | Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 | 356 | 507 | 3.0E-18 |
sp|Q0HR33|PSD_SHESR | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 | 356 | 504 | 3.0E-18 |
sp|A0KSQ8|PSD_SHESA | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 | 356 | 504 | 3.0E-18 |
sp|B0TU73|PSD_SHEHH | Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 | 356 | 538 | 3.0E-18 |
sp|Q5E2C0|PSD_VIBF1 | Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=psd PE=3 SV=1 | 344 | 536 | 4.0E-18 |
sp|A7MZ50|PSD_VIBCB | Phosphatidylserine decarboxylase proenzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=psd PE=3 SV=1 | 356 | 532 | 4.0E-18 |
sp|A1KBF9|PSD_AZOSB | Phosphatidylserine decarboxylase proenzyme OS=Azoarcus sp. (strain BH72) GN=psd PE=3 SV=1 | 355 | 534 | 5.0E-18 |
sp|A8FRC6|PSD_SHESH | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sediminis (strain HAW-EB3) GN=psd PE=3 SV=1 | 356 | 538 | 6.0E-18 |
sp|B2I1N9|PSD_ACIBC | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 | 149 | 535 | 1.0E-17 |
sp|B9MAC0|PSD_ACIET | Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 | 356 | 533 | 1.0E-17 |
sp|B0V9W1|PSD_ACIBY | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 | 149 | 535 | 1.0E-17 |
sp|B7I242|PSD_ACIB5 | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 | 149 | 535 | 1.0E-17 |
sp|B7GUX2|PSD_ACIB3 | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 | 149 | 535 | 1.0E-17 |
sp|Q5ZRA9|PSD_LEGPH | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 | 356 | 537 | 1.0E-17 |
sp|B5FBS2|PSD_VIBFM | Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain MJ11) GN=psd PE=3 SV=1 | 344 | 536 | 1.0E-17 |
sp|A3MA23|PSD_ACIBT | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 | 149 | 535 | 1.0E-17 |
sp|Q5QVW0|PSD_IDILO | Phosphatidylserine decarboxylase proenzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=psd PE=3 SV=1 | 344 | 508 | 2.0E-17 |
sp|Q02F61|PSD_PSEAB | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=psd PE=3 SV=1 | 188 | 504 | 2.0E-17 |
sp|B7V346|PSD_PSEA8 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=psd PE=3 SV=1 | 188 | 504 | 2.0E-17 |
sp|Q47C25|PSD_DECAR | Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 | 356 | 534 | 2.0E-17 |
sp|Q10949|PISD_CAEEL | Phosphatidylserine decarboxylase proenzyme OS=Caenorhabditis elegans GN=psd-1 PE=3 SV=2 | 148 | 267 | 3.0E-17 |
sp|Q87DS7|PSD_XYLFT | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=psd PE=3 SV=1 | 188 | 262 | 3.0E-17 |
sp|B2I9I2|PSD_XYLF2 | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M23) GN=psd PE=3 SV=1 | 188 | 262 | 3.0E-17 |
sp|A2SJL1|PSD_METPP | Phosphatidylserine decarboxylase proenzyme OS=Methylibium petroleiphilum (strain PM1) GN=psd PE=3 SV=1 | 356 | 533 | 3.0E-17 |
sp|Q5X0Q0|PSD_LEGPA | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 | 356 | 537 | 3.0E-17 |
sp|Q5WSH5|PSD_LEGPL | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 | 356 | 537 | 3.0E-17 |
sp|A5IIH5|PSD_LEGPC | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 | 356 | 537 | 4.0E-17 |
sp|Q31H64|PSD_THICR | Phosphatidylserine decarboxylase proenzyme OS=Thiomicrospira crunogena (strain XCL-2) GN=psd PE=3 SV=2 | 357 | 538 | 4.0E-17 |
sp|Q7MGZ5|PSD_VIBVY | Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain YJ016) GN=psd PE=3 SV=1 | 344 | 532 | 5.0E-17 |
sp|Q8DCV8|PSD_VIBVU | Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain CMCP6) GN=psd PE=3 SV=1 | 344 | 532 | 5.0E-17 |
sp|Q9PP76|PSD_CAMJE | Phosphatidylserine decarboxylase proenzyme OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=psd PE=3 SV=1 | 352 | 534 | 5.0E-17 |
sp|Q1GZE8|PSD_METFK | Phosphatidylserine decarboxylase proenzyme OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=psd PE=3 SV=1 | 344 | 518 | 6.0E-17 |
sp|B0VP52|PSD_ACIBS | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain SDF) GN=psd PE=3 SV=1 | 149 | 535 | 6.0E-17 |
sp|Q9HUK8|PSD_PSEAE | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=psd PE=3 SV=1 | 188 | 504 | 6.0E-17 |
sp|Q15Q53|PSD_PSEA6 | Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=psd PE=3 SV=1 | 356 | 505 | 7.0E-17 |
sp|Q8P7Q6|PSD_XANCP | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=psd PE=3 SV=1 | 188 | 265 | 7.0E-17 |
sp|B0RR72|PSD_XANCB | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain B100) GN=psd PE=3 SV=1 | 188 | 265 | 7.0E-17 |
sp|Q4UWE4|PSD_XANC8 | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain 8004) GN=psd PE=3 SV=1 | 188 | 265 | 7.0E-17 |
sp|Q2SBA8|PSD_HAHCH | Phosphatidylserine decarboxylase proenzyme OS=Hahella chejuensis (strain KCTC 2396) GN=psd PE=3 SV=1 | 356 | 536 | 7.0E-17 |
sp|Q8PJ17|PSD_XANAC | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas axonopodis pv. citri (strain 306) GN=psd PE=3 SV=1 | 188 | 264 | 9.0E-17 |
sp|O25911|PSD_HELPY | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=psd PE=3 SV=1 | 353 | 534 | 1.0E-16 |
sp|Q1CRQ1|PSD_HELPH | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain HPAG1) GN=psd PE=3 SV=1 | 353 | 535 | 1.0E-16 |
sp|Q6LM21|PSD_PHOPR | Phosphatidylserine decarboxylase proenzyme OS=Photobacterium profundum GN=psd PE=3 SV=1 | 356 | 539 | 1.0E-16 |
sp|B8F658|PSD_HAEPS | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=psd PE=3 SV=1 | 356 | 537 | 1.0E-16 |
sp|B6EMR5|PSD_ALISL | Phosphatidylserine decarboxylase proenzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=psd PE=3 SV=1 | 356 | 538 | 2.0E-16 |
sp|C3LR71|PSD_VIBCM | Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain M66-2) GN=psd PE=3 SV=1 | 356 | 532 | 2.0E-16 |
sp|Q9KV19|PSD_VIBCH | Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=psd PE=3 SV=1 | 356 | 532 | 2.0E-16 |
sp|A5F3N7|PSD_VIBC3 | Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=psd PE=3 SV=1 | 356 | 532 | 2.0E-16 |
sp|C4K3T9|PSD_HAMD5 | Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 | 344 | 534 | 2.0E-16 |
sp|B5Y342|PSD_KLEP3 | Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae (strain 342) GN=psd PE=3 SV=1 | 356 | 542 | 2.0E-16 |
sp|Q221E5|PSD_RHOFT | Phosphatidylserine decarboxylase proenzyme OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=psd PE=3 SV=2 | 355 | 535 | 3.0E-16 |
sp|Q9ZJN0|PSD_HELPJ | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=psd PE=3 SV=1 | 353 | 535 | 3.0E-16 |
sp|B0BR01|PSD_ACTPJ | Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=psd PE=3 SV=1 | 348 | 536 | 3.0E-16 |
sp|B3H2F9|PSD_ACTP7 | Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=psd PE=3 SV=1 | 348 | 536 | 3.0E-16 |
sp|A3N255|PSD_ACTP2 | Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=psd PE=3 SV=1 | 348 | 536 | 4.0E-16 |
sp|B0U6J7|PSD_XYLFM | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M12) GN=psd PE=3 SV=1 | 188 | 262 | 4.0E-16 |
sp|Q9PDL4|PSD_XYLFA | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain 9a5c) GN=psd PE=3 SV=1 | 188 | 262 | 4.0E-16 |
sp|Q3BRK2|PSD_XANC5 | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=psd PE=3 SV=1 | 188 | 264 | 7.0E-16 |
sp|B6JNM7|PSD_HELP2 | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain P12) GN=psd PE=3 SV=1 | 353 | 535 | 8.0E-16 |
sp|A6VD70|PSD_PSEA7 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain PA7) GN=psd PE=3 SV=1 | 188 | 504 | 1.0E-15 |
sp|Q1Q8K8|PSD_PSYCK | Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 | 356 | 534 | 1.0E-15 |
sp|Q47VZ2|PSD_COLP3 | Phosphatidylserine decarboxylase proenzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-15 |
sp|Q2NW88|PSD_SODGM | Phosphatidylserine decarboxylase proenzyme OS=Sodalis glossinidius (strain morsitans) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-15 |
sp|B4S0J5|PSD_ALTMD | Phosphatidylserine decarboxylase proenzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=psd PE=3 SV=1 | 356 | 534 | 2.0E-15 |
sp|Q21H90|PSD_SACD2 | Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 | 356 | 536 | 2.0E-15 |
sp|B2UVC1|PSD_HELPS | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain Shi470) GN=psd PE=3 SV=1 | 353 | 535 | 2.0E-15 |
sp|A1SZV9|PSD_PSYIN | Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 | 356 | 504 | 2.0E-15 |
sp|A8AMN8|PSD_CITK8 | Phosphatidylserine decarboxylase proenzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=psd PE=3 SV=1 | 356 | 538 | 2.0E-15 |
sp|B8JBF7|PSD_ANAD2 | Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=psd PE=3 SV=1 | 149 | 265 | 3.0E-15 |
sp|Q1LSP9|PSD_BAUCH | Phosphatidylserine decarboxylase proenzyme OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=psd PE=3 SV=1 | 344 | 504 | 3.0E-15 |
sp|Q83AQ4|PSD_COXBU | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=psd PE=3 SV=1 | 356 | 537 | 4.0E-15 |
sp|A9NAS0|PSD_COXBR | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=psd PE=3 SV=1 | 356 | 537 | 4.0E-15 |
sp|B6J316|PSD_COXB2 | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuG_Q212) GN=psd PE=3 SV=1 | 356 | 537 | 4.0E-15 |
sp|B6J9C5|PSD_COXB1 | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuK_Q154) GN=psd PE=3 SV=1 | 356 | 537 | 4.0E-15 |
sp|A9MFQ0|PSD_SALAR | Phosphatidylserine decarboxylase proenzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=psd PE=3 SV=1 | 356 | 539 | 4.0E-15 |
sp|A9KEZ8|PSD_COXBN | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=psd PE=3 SV=1 | 356 | 537 | 4.0E-15 |
sp|C1DLP2|PSD_AZOVD | Phosphatidylserine decarboxylase proenzyme OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=psd PE=3 SV=1 | 155 | 265 | 5.0E-15 |
sp|B4UEL4|PSD_ANASK | Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter sp. (strain K) GN=psd PE=3 SV=1 | 149 | 265 | 7.0E-15 |
sp|Q7MYS6|PSD_PHOLL | Phosphatidylserine decarboxylase proenzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psd PE=3 SV=1 | 356 | 550 | 8.0E-15 |
sp|Q4KJ87|PSD_PSEF5 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 | 155 | 262 | 8.0E-15 |
sp|B4SQW4|PSD_STRM5 | Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain R551-3) GN=psd PE=3 SV=1 | 188 | 263 | 8.0E-15 |
sp|C0Q6C0|PSD_SALPC | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi C (strain RKS4594) GN=psd PE=3 SV=1 | 356 | 538 | 9.0E-15 |
sp|A1JIQ6|PSD_YERE8 | Phosphatidylserine decarboxylase proenzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=psd PE=3 SV=1 | 356 | 504 | 9.0E-15 |
sp|Q8ZKB1|PSD_SALTY | Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B4TSE2|PSD_SALSV | Phosphatidylserine decarboxylase proenzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B5BKH1|PSD_SALPK | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|A9N419|PSD_SALPB | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|Q5PLG9|PSD_SALPA | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B4T2Q7|PSD_SALNS | Phosphatidylserine decarboxylase proenzyme OS=Salmonella newport (strain SL254) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B4TF96|PSD_SALHS | Phosphatidylserine decarboxylase proenzyme OS=Salmonella heidelberg (strain SL476) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B5R9A9|PSD_SALG2 | Phosphatidylserine decarboxylase proenzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B5R023|PSD_SALEP | Phosphatidylserine decarboxylase proenzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|B5FRL8|PSD_SALDC | Phosphatidylserine decarboxylase proenzyme OS=Salmonella dublin (strain CT_02021853) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|Q57GM9|PSD_SALCH | Phosphatidylserine decarboxylase proenzyme OS=Salmonella choleraesuis (strain SC-B67) GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|A7MMA5|PSD_CROS8 | Phosphatidylserine decarboxylase proenzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=psd PE=3 SV=1 | 356 | 533 | 1.0E-14 |
sp|B1JMP9|PSD_YERPY | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|Q66FC4|PSD_YERPS | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|A4TRP9|PSD_YERPP | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis (strain Pestoides F) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|Q1CEE6|PSD_YERPN | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|A9QYP0|PSD_YERPG | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Angola) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|Q8ZIX1|PSD_YERPE | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|B2K1Z5|PSD_YERPB | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|Q1C0Z1|PSD_YERPA | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|A7FMY9|PSD_YERP3 | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-14 |
sp|Q5GXQ3|PSD_XANOR | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=psd PE=3 SV=1 | 188 | 262 | 1.0E-14 |
sp|Q8Z194|PSD_SALTI | Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhi GN=psd PE=3 SV=1 | 356 | 538 | 1.0E-14 |
sp|Q2P0T0|PSD_XANOM | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=psd PE=3 SV=1 | 188 | 262 | 1.0E-14 |
sp|Q6F6W3|PSD_ACIAD | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 | 356 | 535 | 2.0E-14 |
sp|A8A7Q7|PSD_ECOHS | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O9:H4 (strain HS) GN=psd PE=3 SV=1 | 356 | 538 | 2.0E-14 |
sp|Q4FQD5|PSD_PSYA2 | Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 | 356 | 534 | 2.0E-14 |
sp|Q88DB9|PSD_PSEPK | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 | 155 | 262 | 2.0E-14 |
sp|A5W9U4|PSD_PSEP1 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 | 155 | 262 | 2.0E-14 |
sp|B2FP04|PSD_STRMK | Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain K279a) GN=psd PE=3 SV=1 | 188 | 262 | 3.0E-14 |
sp|Q6D035|PSD_PECAS | Phosphatidylserine decarboxylase proenzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=psd PE=3 SV=1 | 356 | 506 | 3.0E-14 |
sp|A6TH77|PSD_KLEP7 | Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=psd PE=3 SV=1 | 356 | 532 | 4.0E-14 |
sp|Q9EV04|PSD_DICD3 | Phosphatidylserine decarboxylase proenzyme OS=Dickeya dadantii (strain 3937) GN=psd PE=3 SV=2 | 356 | 504 | 5.0E-14 |
sp|Q1I433|PSD_PSEE4 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 | 188 | 262 | 9.0E-14 |
sp|A4VR22|PSD_PSEU5 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 | 154 | 262 | 1.0E-13 |
sp|B0KL10|PSD_PSEPG | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 | 188 | 262 | 1.0E-13 |
sp|A1WIF0|PSD_VEREI | Phosphatidylserine decarboxylase proenzyme OS=Verminephrobacter eiseniae (strain EF01-2) GN=psd PE=3 SV=1 | 355 | 504 | 1.0E-13 |
sp|Q31H64|PSD_THICR | Phosphatidylserine decarboxylase proenzyme OS=Thiomicrospira crunogena (strain XCL-2) GN=psd PE=3 SV=2 | 146 | 284 | 2.0E-13 |
sp|A7MMA5|PSD_CROS8 | Phosphatidylserine decarboxylase proenzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=psd PE=3 SV=1 | 181 | 262 | 2.0E-13 |
sp|Q2L0K8|PSD_BORA1 | Phosphatidylserine decarboxylase proenzyme OS=Bordetella avium (strain 197N) GN=psd PE=3 SV=1 | 356 | 504 | 2.0E-13 |
sp|A4XPX3|PSD_PSEMY | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 | 155 | 262 | 2.0E-13 |
sp|B2VCV2|PSD_ERWT9 | Phosphatidylserine decarboxylase proenzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=psd PE=3 SV=1 | 356 | 504 | 2.0E-13 |
sp|A4VR22|PSD_PSEU5 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 | 356 | 535 | 3.0E-13 |
sp|Q9EV04|PSD_DICD3 | Phosphatidylserine decarboxylase proenzyme OS=Dickeya dadantii (strain 3937) GN=psd PE=3 SV=2 | 181 | 262 | 4.0E-13 |
sp|Q1QUI2|PSD_CHRSD | Phosphatidylserine decarboxylase proenzyme OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=psd PE=3 SV=1 | 356 | 534 | 4.0E-13 |
sp|Q7VNA7|PSD_HAEDU | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=psd PE=3 SV=1 | 356 | 504 | 4.0E-13 |
sp|C3KDM6|PSD_PSEFS | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 | 147 | 262 | 5.0E-13 |
sp|B1JAE9|PSD_PSEPW | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 | 188 | 262 | 7.0E-13 |
sp|A9IM91|PSD_BORPD | Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 | 356 | 504 | 8.0E-13 |
sp|Q83AQ4|PSD_COXBU | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=psd PE=3 SV=1 | 161 | 263 | 9.0E-13 |
sp|A9NAS0|PSD_COXBR | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=psd PE=3 SV=1 | 161 | 263 | 9.0E-13 |
sp|B6J316|PSD_COXB2 | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuG_Q212) GN=psd PE=3 SV=1 | 161 | 263 | 9.0E-13 |
sp|B6J9C5|PSD_COXB1 | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuK_Q154) GN=psd PE=3 SV=1 | 161 | 263 | 9.0E-13 |
sp|Q2NW88|PSD_SODGM | Phosphatidylserine decarboxylase proenzyme OS=Sodalis glossinidius (strain morsitans) GN=psd PE=3 SV=1 | 183 | 261 | 1.0E-12 |
sp|Q4KJ87|PSD_PSEF5 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 | 356 | 534 | 1.0E-12 |
sp|Q3KJ03|PSD_PSEPF | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 | 155 | 262 | 1.0E-12 |
sp|Q493W4|PSD_BLOPB | Phosphatidylserine decarboxylase proenzyme OS=Blochmannia pennsylvanicus (strain BPEN) GN=psd PE=3 SV=1 | 356 | 512 | 1.0E-12 |
sp|Q608T0|PSD_METCA | Phosphatidylserine decarboxylase proenzyme OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=psd PE=3 SV=1 | 333 | 534 | 1.0E-12 |
sp|Q21H90|PSD_SACD2 | Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 | 149 | 262 | 2.0E-12 |
sp|A9KEZ8|PSD_COXBN | Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=psd PE=3 SV=1 | 161 | 263 | 2.0E-12 |
sp|B4UEL4|PSD_ANASK | Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter sp. (strain K) GN=psd PE=3 SV=1 | 356 | 534 | 2.0E-12 |
sp|B8JBF7|PSD_ANAD2 | Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=psd PE=3 SV=1 | 356 | 534 | 3.0E-12 |
sp|A8A7Q7|PSD_ECOHS | Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O9:H4 (strain HS) GN=psd PE=3 SV=1 | 183 | 262 | 4.0E-12 |
sp|Q88DB9|PSD_PSEPK | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 | 356 | 539 | 4.0E-12 |
sp|A9MFQ0|PSD_SALAR | Phosphatidylserine decarboxylase proenzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=psd PE=3 SV=1 | 181 | 262 | 5.0E-12 |
sp|C0Q6C0|PSD_SALPC | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi C (strain RKS4594) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|Q8ZKB1|PSD_SALTY | Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B4TSE2|PSD_SALSV | Phosphatidylserine decarboxylase proenzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B5BKH1|PSD_SALPK | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|A9N419|PSD_SALPB | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|Q5PLG9|PSD_SALPA | Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B4T2Q7|PSD_SALNS | Phosphatidylserine decarboxylase proenzyme OS=Salmonella newport (strain SL254) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B4TF96|PSD_SALHS | Phosphatidylserine decarboxylase proenzyme OS=Salmonella heidelberg (strain SL476) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B5R9A9|PSD_SALG2 | Phosphatidylserine decarboxylase proenzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B5R023|PSD_SALEP | Phosphatidylserine decarboxylase proenzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B5FRL8|PSD_SALDC | Phosphatidylserine decarboxylase proenzyme OS=Salmonella dublin (strain CT_02021853) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|Q57GM9|PSD_SALCH | Phosphatidylserine decarboxylase proenzyme OS=Salmonella choleraesuis (strain SC-B67) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|Q8Z194|PSD_SALTI | Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhi GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-12 |
sp|B0KL10|PSD_PSEPG | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 | 356 | 539 | 5.0E-12 |
sp|A9L3W8|PSD_SHEB9 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS195) GN=psd PE=3 SV=1 | 148 | 264 | 6.0E-12 |
sp|A6WSW1|PSD_SHEB8 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS185) GN=psd PE=3 SV=1 | 148 | 264 | 6.0E-12 |
sp|B2VCV2|PSD_ERWT9 | Phosphatidylserine decarboxylase proenzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=psd PE=3 SV=1 | 155 | 261 | 6.0E-12 |
sp|A3D015|PSD_SHEB5 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=psd PE=3 SV=1 | 148 | 264 | 7.0E-12 |
sp|B8ECB2|PSD_SHEB2 | Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS223) GN=psd PE=3 SV=1 | 148 | 264 | 7.0E-12 |
sp|A5W9U4|PSD_PSEP1 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 | 356 | 534 | 8.0E-12 |
sp|A4XPX3|PSD_PSEMY | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 | 356 | 534 | 8.0E-12 |
sp|A1JIQ6|PSD_YERE8 | Phosphatidylserine decarboxylase proenzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=psd PE=3 SV=1 | 148 | 261 | 9.0E-12 |
sp|Q07XV9|PSD_SHEFN | Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 | 148 | 262 | 1.0E-11 |
sp|A1SA30|PSD_SHEAM | Phosphatidylserine decarboxylase proenzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=psd PE=3 SV=1 | 148 | 262 | 1.0E-11 |
sp|B5Y342|PSD_KLEP3 | Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae (strain 342) GN=psd PE=3 SV=1 | 181 | 262 | 1.0E-11 |
sp|A6TH77|PSD_KLEP7 | Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=psd PE=3 SV=1 | 181 | 262 | 1.0E-11 |
sp|C0Z4E2|PSD_BREBN | Phosphatidylserine decarboxylase proenzyme OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psd PE=3 SV=1 | 356 | 533 | 1.0E-11 |
sp|Q121P6|PSD_POLSJ | Phosphatidylserine decarboxylase proenzyme OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=psd PE=3 SV=1 | 188 | 262 | 2.0E-11 |
sp|Q8P7Q6|PSD_XANCP | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=psd PE=3 SV=1 | 356 | 535 | 2.0E-11 |
sp|B0RR72|PSD_XANCB | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain B100) GN=psd PE=3 SV=1 | 356 | 535 | 2.0E-11 |
sp|Q4UWE4|PSD_XANC8 | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain 8004) GN=psd PE=3 SV=1 | 356 | 535 | 2.0E-11 |
sp|Q1I433|PSD_PSEE4 | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 | 356 | 539 | 2.0E-11 |
sp|A9IM91|PSD_BORPD | Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 | 156 | 262 | 2.0E-11 |
sp|Q3KJ03|PSD_PSEPF | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 | 356 | 535 | 2.0E-11 |
sp|Q6D035|PSD_PECAS | Phosphatidylserine decarboxylase proenzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=psd PE=3 SV=1 | 165 | 262 | 3.0E-11 |
sp|C5CU16|PSD_VARPS | Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 | 188 | 262 | 4.0E-11 |
sp|Q7P0H6|PSD_CHRVO | Phosphatidylserine decarboxylase proenzyme OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=psd PE=3 SV=1 | 355 | 533 | 4.0E-11 |
sp|Q5QVW0|PSD_IDILO | Phosphatidylserine decarboxylase proenzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=psd PE=3 SV=1 | 142 | 262 | 5.0E-11 |
sp|A8AMN8|PSD_CITK8 | Phosphatidylserine decarboxylase proenzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=psd PE=3 SV=1 | 183 | 262 | 5.0E-11 |
sp|Q5GXQ3|PSD_XANOR | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=psd PE=3 SV=1 | 356 | 527 | 6.0E-11 |
sp|Q5E2C0|PSD_VIBF1 | Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=psd PE=3 SV=1 | 156 | 262 | 7.0E-11 |
sp|Q2P0T0|PSD_XANOM | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=psd PE=3 SV=1 | 356 | 527 | 7.0E-11 |
sp|Q6F6W3|PSD_ACIAD | Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 | 149 | 262 | 9.0E-11 |
sp|C3KDM6|PSD_PSEFS | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 | 356 | 531 | 9.0E-11 |
sp|B5FBS2|PSD_VIBFM | Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain MJ11) GN=psd PE=3 SV=1 | 156 | 262 | 1.0E-10 |
sp|B1JMP9|PSD_YERPY | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|Q66FC4|PSD_YERPS | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|A4TRP9|PSD_YERPP | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis (strain Pestoides F) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|Q1CEE6|PSD_YERPN | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|A9QYP0|PSD_YERPG | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Angola) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|Q8ZIX1|PSD_YERPE | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|B2K1Z5|PSD_YERPB | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|Q1C0Z1|PSD_YERPA | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|A7FMY9|PSD_YERP3 | Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=psd PE=3 SV=1 | 148 | 261 | 1.0E-10 |
sp|B1JAE9|PSD_PSEPW | Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 | 356 | 534 | 1.0E-10 |
sp|B2SFB2|PSD_FRATM | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=psd PE=3 SV=1 | 143 | 262 | 1.0E-10 |
sp|B0TU73|PSD_SHEHH | Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 | 148 | 264 | 2.0E-10 |
sp|Q1GZE8|PSD_METFK | Phosphatidylserine decarboxylase proenzyme OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=psd PE=3 SV=1 | 149 | 262 | 2.0E-10 |
sp|Q2SBA8|PSD_HAHCH | Phosphatidylserine decarboxylase proenzyme OS=Hahella chejuensis (strain KCTC 2396) GN=psd PE=3 SV=1 | 156 | 262 | 2.0E-10 |
sp|Q3BRK2|PSD_XANC5 | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=psd PE=3 SV=1 | 356 | 531 | 2.0E-10 |
sp|B4SQW4|PSD_STRM5 | Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain R551-3) GN=psd PE=3 SV=1 | 344 | 527 | 2.0E-10 |
sp|B2FP04|PSD_STRMK | Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain K279a) GN=psd PE=3 SV=1 | 344 | 527 | 2.0E-10 |
sp|A1WIF0|PSD_VEREI | Phosphatidylserine decarboxylase proenzyme OS=Verminephrobacter eiseniae (strain EF01-2) GN=psd PE=3 SV=1 | 188 | 278 | 2.0E-10 |
sp|A4G529|PSD_HERAR | Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 | 188 | 262 | 3.0E-10 |
sp|A4IZN0|PSD_FRATW | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=psd PE=3 SV=1 | 143 | 262 | 3.0E-10 |
sp|Q5NHR3|PSD_FRATT | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=psd PE=3 SV=2 | 143 | 262 | 3.0E-10 |
sp|Q0BN99|PSD_FRATO | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=psd PE=3 SV=1 | 143 | 262 | 3.0E-10 |
sp|Q2A4Y0|PSD_FRATH | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain LVS) GN=psd PE=3 SV=1 | 143 | 262 | 3.0E-10 |
sp|A7NAF0|PSD_FRATF | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=psd PE=3 SV=1 | 143 | 262 | 3.0E-10 |
sp|Q14J65|PSD_FRAT1 | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=psd PE=3 SV=1 | 143 | 262 | 3.0E-10 |
sp|Q87DS7|PSD_XYLFT | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=psd PE=3 SV=1 | 347 | 543 | 4.0E-10 |
sp|B2I9I2|PSD_XYLF2 | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M23) GN=psd PE=3 SV=1 | 347 | 543 | 4.0E-10 |
sp|Q8PJ17|PSD_XANAC | Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas axonopodis pv. citri (strain 306) GN=psd PE=3 SV=1 | 356 | 531 | 4.0E-10 |
sp|B6EMR5|PSD_ALISL | Phosphatidylserine decarboxylase proenzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=psd PE=3 SV=1 | 156 | 262 | 4.0E-10 |
sp|Q1LSP9|PSD_BAUCH | Phosphatidylserine decarboxylase proenzyme OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=psd PE=3 SV=1 | 182 | 265 | 4.0E-10 |
sp|Q2L0K8|PSD_BORA1 | Phosphatidylserine decarboxylase proenzyme OS=Bordetella avium (strain 197N) GN=psd PE=3 SV=1 | 177 | 262 | 4.0E-10 |
sp|B0TZM7|PSD_FRAP2 | Phosphatidylserine decarboxylase proenzyme OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=psd PE=3 SV=1 | 188 | 262 | 4.0E-10 |
sp|Q24UV7|PSD_DESHY | Phosphatidylserine decarboxylase proenzyme OS=Desulfitobacterium hafniense (strain Y51) GN=psd PE=3 SV=1 | 182 | 261 | 5.0E-10 |
sp|A8FRC6|PSD_SHESH | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sediminis (strain HAW-EB3) GN=psd PE=3 SV=1 | 148 | 264 | 6.0E-10 |
sp|A4YAL8|PSD_SHEPC | Phosphatidylserine decarboxylase proenzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=psd PE=3 SV=1 | 148 | 284 | 7.0E-10 |
sp|B9MAC0|PSD_ACIET | Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 | 188 | 262 | 7.0E-10 |
sp|B8FQ96|PSD_DESHD | Phosphatidylserine decarboxylase proenzyme OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=psd PE=3 SV=1 | 177 | 261 | 7.0E-10 |
sp|A0Q562|PSD_FRATN | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. novicida (strain U112) GN=psd PE=3 SV=1 | 188 | 262 | 7.0E-10 |
sp|Q0HMP8|PSD_SHESM | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-4) GN=psd PE=3 SV=1 | 148 | 264 | 8.0E-10 |
sp|Q0HR33|PSD_SHESR | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 | 148 | 264 | 8.0E-10 |
sp|B0U6J7|PSD_XYLFM | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M12) GN=psd PE=3 SV=1 | 347 | 543 | 8.0E-10 |
sp|Q47VZ2|PSD_COLP3 | Phosphatidylserine decarboxylase proenzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=psd PE=3 SV=1 | 148 | 268 | 8.0E-10 |
sp|A0KSQ8|PSD_SHESA | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 | 148 | 264 | 9.0E-10 |
sp|Q493W4|PSD_BLOPB | Phosphatidylserine decarboxylase proenzyme OS=Blochmannia pennsylvanicus (strain BPEN) GN=psd PE=3 SV=1 | 183 | 262 | 9.0E-10 |
sp|Q0TV39|PSD_CLOP1 | Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 | 158 | 261 | 9.0E-10 |
sp|Q3IFN3|PSD_PSEHT | Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=psd PE=3 SV=2 | 148 | 262 | 1.0E-09 |
sp|Q8D2C6|PSD_WIGBR | Phosphatidylserine decarboxylase proenzyme OS=Wigglesworthia glossinidia brevipalpis GN=psd PE=3 SV=1 | 356 | 504 | 1.0E-09 |
sp|A4GNA8|PSD3_ARATH | Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 | 357 | 510 | 1.0E-09 |
sp|B2UX63|PSD_CLOBA | Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=psd PE=3 SV=1 | 158 | 261 | 1.0E-09 |
sp|Q8XPD5|PSD_CLOPE | Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain 13 / Type A) GN=psd PE=3 SV=1 | 158 | 261 | 1.0E-09 |
sp|A8H8H5|PSD_SHEPA | Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 | 148 | 264 | 2.0E-09 |
sp|A9C3H8|PSD_DELAS | Phosphatidylserine decarboxylase proenzyme OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=psd PE=3 SV=1 | 155 | 262 | 2.0E-09 |
sp|C4K3T9|PSD_HAMD5 | Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 | 148 | 265 | 2.0E-09 |
sp|Q7VQP8|PSD_BLOFL | Phosphatidylserine decarboxylase proenzyme OS=Blochmannia floridanus GN=psd PE=3 SV=1 | 183 | 262 | 2.0E-09 |
sp|A1RFQ8|PSD_SHESW | Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain W3-18-1) GN=psd PE=3 SV=1 | 148 | 264 | 3.0E-09 |
sp|Q7MYS6|PSD_PHOLL | Phosphatidylserine decarboxylase proenzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psd PE=3 SV=1 | 148 | 262 | 3.0E-09 |
sp|C0Z4E2|PSD_BREBN | Phosphatidylserine decarboxylase proenzyme OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psd PE=3 SV=1 | 151 | 262 | 3.0E-09 |
sp|B0TZM7|PSD_FRAP2 | Phosphatidylserine decarboxylase proenzyme OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=psd PE=3 SV=1 | 336 | 503 | 3.0E-09 |
sp|Q8D2C6|PSD_WIGBR | Phosphatidylserine decarboxylase proenzyme OS=Wigglesworthia glossinidia brevipalpis GN=psd PE=3 SV=1 | 155 | 263 | 3.0E-09 |
sp|B7GKA2|PSD_ANOFW | Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 | 184 | 262 | 3.0E-09 |
sp|Q9PDL4|PSD_XYLFA | Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain 9a5c) GN=psd PE=3 SV=1 | 356 | 543 | 4.0E-09 |
sp|A1VUQ1|PSD_POLNA | Phosphatidylserine decarboxylase proenzyme OS=Polaromonas naphthalenivorans (strain CJ2) GN=psd PE=3 SV=1 | 190 | 262 | 5.0E-09 |
sp|C3LR71|PSD_VIBCM | Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain M66-2) GN=psd PE=3 SV=1 | 188 | 262 | 5.0E-09 |
sp|Q9KV19|PSD_VIBCH | Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=psd PE=3 SV=1 | 188 | 262 | 5.0E-09 |
sp|A5F3N7|PSD_VIBC3 | Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=psd PE=3 SV=1 | 188 | 262 | 5.0E-09 |
sp|Q0SWT6|PSD_CLOPS | Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 | 158 | 261 | 5.0E-09 |
sp|P0CD79|PSD_CHLTR | Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=psd PE=3 SV=1 | 357 | 436 | 5.0E-09 |
sp|Q3KKZ5|PSD_CHLTA | Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=psd PE=3 SV=1 | 357 | 436 | 5.0E-09 |
sp|B0B8S5|PSD_CHLT2 | Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=psd PE=3 SV=1 | 357 | 436 | 5.0E-09 |
sp|B0BAF4|PSD_CHLTB | Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=psd PE=3 SV=1 | 357 | 436 | 5.0E-09 |
sp|B1KHV8|PSD_SHEWM | Phosphatidylserine decarboxylase proenzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=psd PE=3 SV=1 | 148 | 264 | 6.0E-09 |
sp|A2SJL1|PSD_METPP | Phosphatidylserine decarboxylase proenzyme OS=Methylibium petroleiphilum (strain PM1) GN=psd PE=3 SV=1 | 190 | 262 | 6.0E-09 |
sp|Q7P0H6|PSD_CHRVO | Phosphatidylserine decarboxylase proenzyme OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=psd PE=3 SV=1 | 155 | 261 | 7.0E-09 |
sp|Q1QUI2|PSD_CHRSD | Phosphatidylserine decarboxylase proenzyme OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=psd PE=3 SV=1 | 155 | 262 | 8.0E-09 |
sp|A3QAD1|PSD_SHELP | Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 | 148 | 264 | 9.0E-09 |
sp|Q12J86|PSD_SHEDO | Phosphatidylserine decarboxylase proenzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=psd PE=3 SV=1 | 188 | 262 | 1.0E-08 |
sp|B8F658|PSD_HAEPS | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=psd PE=3 SV=1 | 162 | 262 | 1.0E-08 |
sp|Q1Q8K8|PSD_PSYCK | Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 | 149 | 262 | 1.0E-08 |
sp|Q4FQD5|PSD_PSYA2 | Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 | 149 | 262 | 1.0E-08 |
sp|F4KAK5|PSD2_ARATH | Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 | 357 | 508 | 1.0E-08 |
sp|A0Q562|PSD_FRATN | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. novicida (strain U112) GN=psd PE=3 SV=1 | 344 | 538 | 2.0E-08 |
sp|A7GT32|PSD_BACCN | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 | 166 | 264 | 2.0E-08 |
sp|A6LPC8|PSD_CLOB8 | Phosphatidylserine decarboxylase proenzyme OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=psd PE=3 SV=1 | 158 | 262 | 2.0E-08 |
sp|Q47C25|PSD_DECAR | Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 | 188 | 262 | 3.0E-08 |
sp|B4S0J5|PSD_ALTMD | Phosphatidylserine decarboxylase proenzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=psd PE=3 SV=1 | 148 | 264 | 3.0E-08 |
sp|Q7VQP8|PSD_BLOFL | Phosphatidylserine decarboxylase proenzyme OS=Blochmannia floridanus GN=psd PE=3 SV=1 | 356 | 505 | 3.0E-08 |
sp|A8MJ83|PSD_ALKOO | Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 | 190 | 261 | 3.0E-08 |
sp|Q6HDI5|PSD_BACHK | Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-08 |
sp|A0Q3R9|PSD_CLONN | Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 | 158 | 261 | 3.0E-08 |
sp|B2THF2|PSD_CLOBB | Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=psd PE=3 SV=1 | 158 | 261 | 3.0E-08 |
sp|B2SFB2|PSD_FRATM | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=psd PE=3 SV=1 | 336 | 538 | 4.0E-08 |
sp|A4IZN0|PSD_FRATW | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=psd PE=3 SV=1 | 336 | 538 | 4.0E-08 |
sp|Q5NHR3|PSD_FRATT | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=psd PE=3 SV=2 | 336 | 538 | 4.0E-08 |
sp|Q0BN99|PSD_FRATO | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=psd PE=3 SV=1 | 336 | 538 | 4.0E-08 |
sp|Q2A4Y0|PSD_FRATH | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain LVS) GN=psd PE=3 SV=1 | 336 | 538 | 4.0E-08 |
sp|A7NAF0|PSD_FRATF | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=psd PE=3 SV=1 | 336 | 538 | 4.0E-08 |
sp|Q14J65|PSD_FRAT1 | Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=psd PE=3 SV=1 | 336 | 538 | 4.0E-08 |
sp|Q5JN42|PSD2_ORYSJ | Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 | 357 | 508 | 5.0E-08 |
sp|Q221E5|PSD_RHOFT | Phosphatidylserine decarboxylase proenzyme OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=psd PE=3 SV=2 | 188 | 278 | 6.0E-08 |
sp|B0BR01|PSD_ACTPJ | Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=psd PE=3 SV=1 | 139 | 262 | 6.0E-08 |
sp|B3H2F9|PSD_ACTP7 | Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=psd PE=3 SV=1 | 139 | 262 | 6.0E-08 |
sp|A3N255|PSD_ACTP2 | Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=psd PE=3 SV=1 | 139 | 262 | 6.0E-08 |
sp|C5D4W6|PSD_GEOSW | Phosphatidylserine decarboxylase proenzyme OS=Geobacillus sp. (strain WCH70) GN=psd PE=3 SV=1 | 166 | 262 | 6.0E-08 |
sp|B2UVC1|PSD_HELPS | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain Shi470) GN=psd PE=3 SV=1 | 159 | 266 | 7.0E-08 |
sp|Q608T0|PSD_METCA | Phosphatidylserine decarboxylase proenzyme OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=psd PE=3 SV=1 | 150 | 262 | 7.0E-08 |
sp|C1ESN2|PSD_BACC3 | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain 03BB102) GN=psd PE=3 SV=1 | 166 | 264 | 7.0E-08 |
sp|A0RIV4|PSD_BACAH | Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis (strain Al Hakam) GN=psd PE=3 SV=1 | 166 | 264 | 7.0E-08 |
sp|Q5ZRA9|PSD_LEGPH | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 | 155 | 262 | 8.0E-08 |
sp|Q5WSH5|PSD_LEGPL | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 | 155 | 262 | 9.0E-08 |
sp|A5IIH5|PSD_LEGPC | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 | 155 | 262 | 9.0E-08 |
sp|Q5X0Q0|PSD_LEGPA | Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 | 155 | 262 | 1.0E-07 |
sp|A7MZ50|PSD_VIBCB | Phosphatidylserine decarboxylase proenzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=psd PE=3 SV=1 | 188 | 262 | 2.0E-07 |
sp|A1KBF9|PSD_AZOSB | Phosphatidylserine decarboxylase proenzyme OS=Azoarcus sp. (strain BH72) GN=psd PE=3 SV=1 | 188 | 262 | 2.0E-07 |
sp|Q9ZJN0|PSD_HELPJ | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=psd PE=3 SV=1 | 159 | 266 | 2.0E-07 |
sp|B6JNM7|PSD_HELP2 | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain P12) GN=psd PE=3 SV=1 | 159 | 266 | 2.0E-07 |
sp|P53037|PSD2_YEAST | Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 | 358 | 432 | 2.0E-07 |
sp|Q5KWX3|PSD_GEOKA | Phosphatidylserine decarboxylase proenzyme OS=Geobacillus kaustophilus (strain HTA426) GN=psd PE=3 SV=1 | 184 | 262 | 2.0E-07 |
sp|Q9Z767|PSD_CHLPN | Phosphatidylserine decarboxylase proenzyme OS=Chlamydia pneumoniae GN=psd PE=3 SV=1 | 344 | 436 | 2.0E-07 |
sp|Q818C6|PSD_BACCR | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-07 |
sp|B7HCW5|PSD_BACC4 | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-07 |
sp|Q81LP7|PSD_BACAN | Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-07 |
sp|C3L5U2|PSD_BACAC | Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-07 |
sp|C3P929|PSD_BACAA | Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain A0248) GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-07 |
sp|B7IYJ1|PSD_BACC2 | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain G9842) GN=psd PE=3 SV=1 | 166 | 264 | 3.0E-07 |
sp|Q7MGZ5|PSD_VIBVY | Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain YJ016) GN=psd PE=3 SV=1 | 188 | 262 | 4.0E-07 |
sp|Q8DCV8|PSD_VIBVU | Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain CMCP6) GN=psd PE=3 SV=1 | 188 | 262 | 4.0E-07 |
sp|O25911|PSD_HELPY | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=psd PE=3 SV=1 | 159 | 266 | 4.0E-07 |
sp|Q1CRQ1|PSD_HELPH | Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain HPAG1) GN=psd PE=3 SV=1 | 159 | 266 | 4.0E-07 |
sp|Q6LM21|PSD_PHOPR | Phosphatidylserine decarboxylase proenzyme OS=Photobacterium profundum GN=psd PE=3 SV=1 | 148 | 262 | 4.0E-07 |
sp|B7HPN7|PSD_BACC7 | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH187) GN=psd PE=3 SV=1 | 166 | 264 | 4.0E-07 |
sp|B7JNX0|PSD_BACC0 | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH820) GN=psd PE=3 SV=1 | 166 | 264 | 4.0E-07 |
sp|Q634K5|PSD_BACCZ | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ZK / E33L) GN=psd PE=3 SV=1 | 166 | 264 | 4.0E-07 |
sp|Q2YB83|PSD_NITMU | Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 | 188 | 265 | 5.0E-07 |
sp|Q730J7|PSD_BACC1 | Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 | 166 | 264 | 5.0E-07 |
sp|A9VHW5|PSD_BACWK | Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 | 166 | 264 | 5.0E-07 |
sp|Q9PLM7|PSD_CHLMU | Phosphatidylserine decarboxylase proenzyme OS=Chlamydia muridarum (strain MoPn / Nigg) GN=psd PE=3 SV=1 | 357 | 436 | 7.0E-07 |
sp|A1SZV9|PSD_PSYIN | Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 | 155 | 262 | 8.0E-07 |
sp|Q9KDA3|PSD_BACHD | Phosphatidylserine decarboxylase proenzyme OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=psd PE=3 SV=1 | 172 | 264 | 8.0E-07 |
sp|Q7VNA7|PSD_HAEDU | Phosphatidylserine decarboxylase proenzyme OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=psd PE=3 SV=1 | 164 | 263 | 1.0E-06 |
sp|Q8RGF2|PSD_FUSNN | Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 | 182 | 264 | 1.0E-06 |
sp|A7G9C7|PSD_CLOBL | Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psd PE=3 SV=1 | 158 | 262 | 1.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0008654 | phospholipid biosynthetic process | Yes |
GO:0004609 | phosphatidylserine decarboxylase activity | Yes |
GO:0044237 | cellular metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0008610 | lipid biosynthetic process | No |
GO:0044238 | primary metabolic process | No |
GO:0006629 | lipid metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0009987 | cellular process | No |
GO:0009058 | biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0090407 | organophosphate biosynthetic process | No |
GO:0016830 | carbon-carbon lyase activity | No |
GO:0016831 | carboxy-lyase activity | No |
GO:0006644 | phospholipid metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0006796 | phosphate-containing compound metabolic process | No |
GO:0044255 | cellular lipid metabolic process | No |
GO:0016829 | lyase activity | No |
GO:0006793 | phosphorus metabolic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0019637 | organophosphate metabolic process | No |
GO:0008150 | biological_process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 20 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|5973 MNAVIGAGPCPLLRRRVLAAVHRPCPGCASPNVRSTTDAGFRGLRQMFGARRSYVSDAGKRPRFSKRLGEALRRS RIQWYQIPVGLGVAFLGVLQINKVISRELETDAAQQKQRPKARPEGPWHVNPRRRASSAVCILWNKADTRFRQVQ VMSTLPLKAISRLWGRFNELTIPYYLRVPGFKLYSFIFGVNLDEVSEPDLHVYPNLAAFFYRTLKPGVRPLDPDP NALLSPSDGKVLQFGRIEGGDIEQVKGMTYSIDALLGKKTPPPSIQSSSDDSHGDEAIVKQEEEFAQVNGISYTL PDLLTGPKSTKPRQAVTDESTEASPRAVSEVRADLALGERPWYEALSANETTALYYAVVYLAPGDYHRFHSPTNW VVERRRHFPGELFSVSPYLQRTLPGLFTLNERVVLIGRWRHGFFSYTPVGATNVGSIRVNFDRELRTNSLTTDTA ADQAAAEAAKRGESYLDYVEATYEGASAVLRGHALRRGEEMGGFQLGSTVVLVFEAPADKRAGAPGWEWCVEKGQ KVKMGQPLGRVSEAGTGEASTKKIS* |
Coding | >Ophun1|5973 ATGAACGCCGTCATCGGAGCCGGCCCCTGTCCGCTCCTTCGACGCCGCGTTCTCGCAGCTGTCCACAGGCCATGT CCAGGATGCGCATCTCCCAATGTCAGGTCAACAACGGATGCCGGCTTTCGGGGCCTCCGGCAGATGTTTGGCGCG CGAAGAAGCTATGTCTCCGACGCTGGCAAGCGGCCACGCTTCTCCAAACGTCTCGGCGAGGCCCTTCGCCGCAGT AGGATCCAATGGTATCAAATTCCCGTCGGTCTCGGCGTAGCCTTCCTCGGCGTCTTGCAGATCAACAAGGTCATC TCGAGAGAGCTGGAGACCGATGCGGCACAGCAAAAGCAGCGGCCCAAGGCGCGGCCTGAAGGACCATGGCATGTC AACCCACGCCGCAGAGCATCATCGGCGGTCTGCATTCTATGGAACAAAGCTGACACTCGCTTCAGGCAAGTTCAG GTCATGTCGACTCTGCCGCTCAAGGCCATCTCTCGGCTCTGGGGTCGGTTCAACGAGCTGACGATTCCCTACTAC CTGCGCGTCCCTGGCTTCAAGCTATACTCGTTCATCTTTGGCGTCAACCTCGACGAGGTCTCCGAGCCAGATCTC CACGTCTATCCCAATCTAGCCGCCTTTTTCTACCGCACTCTCAAACCGGGTGTTCGACCATTGGATCCAGATCCA AACGCTCTGCTCTCACCGTCGGATGGCAAGGTTCTCCAGTTCGGTCGAATCGAGGGCGGCGACATTGAGCAGGTC AAAGGGATGACGTACAGCATCGACGCGTTACTTGGCAAGAAAACACCGCCTCCCAGCATACAAAGCTCCAGCGAC GATTCGCACGGCGATGAAGCCATTGTCAAGCAGGAAGAGGAATTCGCCCAGGTCAACGGCATCTCCTACACGCTC CCCGACCTCCTGACAGGGCCGAAAAGCACCAAGCCTCGACAGGCGGTGACGGACGAGTCGACCGAGGCATCGCCG CGGGCCGTATCCGAAGTCCGGGCGGATCTGGCCCTCGGCGAGCGGCCATGGTACGAAGCACTCTCCGCCAACGAG ACGACAGCGCTCTACTACGCCGTAGTTTACCTGGCGCCCGGCGACTACCATCGCTTCCACTCGCCGACCAATTGG GTCGTCGAGCGACGGCGACACTTCCCAGGCGAGCTGTTCAGTGTATCGCCCTACCTCCAGCGGACGCTACCTGGC CTCTTCACGCTCAACGAGCGCGTGGTGCTAATCGGCCGCTGGCGACACGGCTTCTTTAGCTACACCCCCGTCGGT GCCACCAACGTCGGCTCCATCCGCGTCAACTTCGACCGCGAACTGCGAACAAATAGCCTCACGACGGACACGGCG GCCGATCAGGCGGCAGCTGAGGCGGCCAAGCGAGGGGAGTCTTACCTCGACTACGTTGAGGCGACGTACGAGGGG GCCAGCGCCGTGCTGCGAGGCCATGCGCTGCGCAGGGGAGAGGAGATGGGCGGATTCCAGCTGGGCAGCACCGTC GTCCTCGTCTTCGAGGCTCCGGCCGATAAACGCGCTGGGGCACCGGGCTGGGAGTGGTGTGTGGAAAAGGGGCAG AAGGTGAAGATGGGACAGCCGCTGGGGCGGGTTTCCGAGGCTGGGACGGGAGAGGCCTCGACGAAGAAGATCAGC TGA |
Transcript | >Ophun1|5973 ATGAACGCCGTCATCGGAGCCGGCCCCTGTCCGCTCCTTCGACGCCGCGTTCTCGCAGCTGTCCACAGGCCATGT CCAGGATGCGCATCTCCCAATGTCAGGTCAACAACGGATGCCGGCTTTCGGGGCCTCCGGCAGATGTTTGGCGCG CGAAGAAGCTATGTCTCCGACGCTGGCAAGCGGCCACGCTTCTCCAAACGTCTCGGCGAGGCCCTTCGCCGCAGT AGGATCCAATGGTATCAAATTCCCGTCGGTCTCGGCGTAGCCTTCCTCGGCGTCTTGCAGATCAACAAGGTCATC TCGAGAGAGCTGGAGACCGATGCGGCACAGCAAAAGCAGCGGCCCAAGGCGCGGCCTGAAGGACCATGGCATGTC AACCCACGCCGCAGAGCATCATCGGCGGTCTGCATTCTATGGAACAAAGCTGACACTCGCTTCAGGCAAGTTCAG GTCATGTCGACTCTGCCGCTCAAGGCCATCTCTCGGCTCTGGGGTCGGTTCAACGAGCTGACGATTCCCTACTAC CTGCGCGTCCCTGGCTTCAAGCTATACTCGTTCATCTTTGGCGTCAACCTCGACGAGGTCTCCGAGCCAGATCTC CACGTCTATCCCAATCTAGCCGCCTTTTTCTACCGCACTCTCAAACCGGGTGTTCGACCATTGGATCCAGATCCA AACGCTCTGCTCTCACCGTCGGATGGCAAGGTTCTCCAGTTCGGTCGAATCGAGGGCGGCGACATTGAGCAGGTC AAAGGGATGACGTACAGCATCGACGCGTTACTTGGCAAGAAAACACCGCCTCCCAGCATACAAAGCTCCAGCGAC GATTCGCACGGCGATGAAGCCATTGTCAAGCAGGAAGAGGAATTCGCCCAGGTCAACGGCATCTCCTACACGCTC CCCGACCTCCTGACAGGGCCGAAAAGCACCAAGCCTCGACAGGCGGTGACGGACGAGTCGACCGAGGCATCGCCG CGGGCCGTATCCGAAGTCCGGGCGGATCTGGCCCTCGGCGAGCGGCCATGGTACGAAGCACTCTCCGCCAACGAG ACGACAGCGCTCTACTACGCCGTAGTTTACCTGGCGCCCGGCGACTACCATCGCTTCCACTCGCCGACCAATTGG GTCGTCGAGCGACGGCGACACTTCCCAGGCGAGCTGTTCAGTGTATCGCCCTACCTCCAGCGGACGCTACCTGGC CTCTTCACGCTCAACGAGCGCGTGGTGCTAATCGGCCGCTGGCGACACGGCTTCTTTAGCTACACCCCCGTCGGT GCCACCAACGTCGGCTCCATCCGCGTCAACTTCGACCGCGAACTGCGAACAAATAGCCTCACGACGGACACGGCG GCCGATCAGGCGGCAGCTGAGGCGGCCAAGCGAGGGGAGTCTTACCTCGACTACGTTGAGGCGACGTACGAGGGG GCCAGCGCCGTGCTGCGAGGCCATGCGCTGCGCAGGGGAGAGGAGATGGGCGGATTCCAGCTGGGCAGCACCGTC GTCCTCGTCTTCGAGGCTCCGGCCGATAAACGCGCTGGGGCACCGGGCTGGGAGTGGTGTGTGGAAAAGGGGCAG AAGGTGAAGATGGGACAGCCGCTGGGGCGGGTTTCCGAGGCTGGGACGGGAGAGGCCTCGACGAAGAAGATCAGC TGA |
Gene | >Ophun1|5973 ATGAACGCCGTCATCGGAGCCGGCCCCTGTCCGCTCCTTCGACGCCGCGTTCTCGCAGCTGTCCACAGGCCATGT CCAGGATGCGCATCTCCCAATGTCAGGTCAACAACGGATGCCGGCTTTCGGGGCCTCCGGCAGATGTTTGGCGCG CGAAGAAGCTATGTCTCCGACGCTGGCAAGCGGCCACGCTTCTCCAAACGTCTCGGCGAGGCCCTTCGCCGCAGT AGGATCCAATGGTATCAAATTCCCGTCGGTCTCGGCGTAGCCTTCCTCGGCGTCTTGCAGATCAACAAGGTCATC TCGAGAGAGCTGGAGACCGATGCGGCACAGCAAAAGCAGCGGCCCAAGGCGCGGCCTGAAGGACCATGGCATGTC AACCCACGCCGCAGAGCATCATCGGCGGTCTGCATTCTATGGAACAAAGCTGACACTCGCTTCAGGCAAGTTCAG GTCATGTCGACTCTGCCGCTCAAGGCCATCTCTCGGCTCTGGGGTCGGTTCAACGAGCTGACGATTCCCTACTAC CTGCGCGTCCCTGGCTTCAAGCTATACTCGTTCATCTTTGGCGTCAAGTTTGTGGACAGGCTGCCCAGCTTCCTA TCCCTTTGCTGACACAAGAACAGCCTCGACGAGGTCTCCGAGCCAGATCTCCACGTCTATCCCAATCTAGCCGCC TTTTTCTACCGCACTCTCAAACCGGGTGTTCGACCATTGGATCCAGATCCAAACGCTCTGCTCTCACCGTCGGAT GGCAAGGTTCTCCAGTTCGGTCGAATCGAGGGCGGCGACATTGAGCAGGTCAAAGGGATGACGTACAGCATCGAC GCGTTACTTGGCAAGAAAACACCGCCTCCCAGCATACAAAGCTCCAGCGACGATTCGCACGGCGATGAAGCCATT GTCAAGCAGGAAGAGGAATTCGCCCAGGTCAACGGCATCTCCTACACGCTCCCCGACCTCCTGACAGGGCCGAAA AGCACCAAGCCTCGACAGGCGGTGACGGACGAGTCGACCGAGGCATCGCCGCGGGCCGTATCCGAAGTCCGGGCG GATCTGGCCCTCGGCGAGCGGCCATGGTACGAAGCACTCTCCGCCAACGAGACGACAGCGCTCTACTACGCCGTA GTTTACCTGGCGCCCGGCGACTACCATCGCTTCCACTCGCCGACCAATTGGGTCGTCGAGCGACGGCGACACTTC CCAGGCGAGCTGTTCAGTGTATCGCCCTACCTCCAGCGGACGCTACCTGGCCTCTTCACGCTCAACGAGCGCGTG GTGCTAATCGGCCGCTGGCGACACGGCTTCTTTAGCTACACCCCCGTCGGTGCCACCAACGTCGGCTCCATCCGC GTCAACTTCGACCGCGAACTGCGAACAAATAGCCTCACGACGGACACGGCGGCCGATCAGGCGGCAGCTGAGGCG GCCAAGCGAGGGGAGTCTTACCTCGACTACGTTGAGGCGACGTACGAGGGGGCCAGCGCCGTGCTGCGAGGCCAT GCGCTGCGCAGGGGAGAGGAGATGGGCGGATTCCAGCTGGGCAGCACCGTCGTCCTCGTCTTCGAGGCTCCGGCC GATAAACGCGCTGGGGCACCGGGCTGGGAGTGGTGTGTGGAAAAGGGGCAGAAGGTGAAGATGGGACAGCCGCTG GGGCGGGTTTCCGAGGCTGGGACGGGAGAGGCCTCGACGAAGAAGATCAGCTGA |