Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5973
Gene name
LocationContig_62:18560..20264
Strand+
Gene length (bp)1704
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 4.9E-18 206 266
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 3.7E-58 287 534

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14333|PSD1_SCHPO Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd1 PE=3 SV=4 47 536 3.0E-117
sp|P39006|PSD1_YEAST Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD1 PE=1 SV=1 153 536 2.0E-111
sp|Q9UG56|PISD_HUMAN Phosphatidylserine decarboxylase proenzyme OS=Homo sapiens GN=PISD PE=2 SV=4 148 536 4.0E-73
sp|Q58DH2|PISD_BOVIN Phosphatidylserine decarboxylase proenzyme OS=Bos taurus GN=PISD PE=2 SV=1 148 536 5.0E-73
sp|P27465|PISD_CRIGR Phosphatidylserine decarboxylase proenzyme OS=Cricetulus griseus GN=PISD PE=1 SV=2 148 536 1.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14333|PSD1_SCHPO Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd1 PE=3 SV=4 47 536 3.0E-117
sp|P39006|PSD1_YEAST Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD1 PE=1 SV=1 153 536 2.0E-111
sp|Q9UG56|PISD_HUMAN Phosphatidylserine decarboxylase proenzyme OS=Homo sapiens GN=PISD PE=2 SV=4 148 536 4.0E-73
sp|Q58DH2|PISD_BOVIN Phosphatidylserine decarboxylase proenzyme OS=Bos taurus GN=PISD PE=2 SV=1 148 536 5.0E-73
sp|P27465|PISD_CRIGR Phosphatidylserine decarboxylase proenzyme OS=Cricetulus griseus GN=PISD PE=1 SV=2 148 536 1.0E-72
sp|Q5R8I8|PISD_PONAB Phosphatidylserine decarboxylase proenzyme OS=Pongo abelii GN=PISD PE=2 SV=1 148 536 7.0E-72
sp|Q8BSF4|PISD_MOUSE Phosphatidylserine decarboxylase proenzyme OS=Mus musculus GN=Pisd PE=2 SV=1 148 536 9.0E-72
sp|Q10T43|PSD1_ORYSJ Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Oryza sativa subsp. japonica GN=PSD1 PE=2 SV=1 148 535 6.0E-68
sp|Q84V22|PSD1_ARATH Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Arabidopsis thaliana GN=PSD1 PE=2 SV=1 148 538 9.0E-68
sp|Q9UTB5|PSD2_SCHPO Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd2 PE=3 SV=1 341 533 4.0E-54
sp|Q10949|PISD_CAEEL Phosphatidylserine decarboxylase proenzyme OS=Caenorhabditis elegans GN=psd-1 PE=3 SV=2 346 533 8.0E-34
sp|A1U4D6|PSD_MARHV Phosphatidylserine decarboxylase proenzyme OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=psd PE=3 SV=1 156 537 4.0E-28
sp|Q0I4T3|PSD_HAES1 Phosphatidylserine decarboxylase proenzyme OS=Haemophilus somnus (strain 129Pt) GN=psd PE=3 SV=1 139 506 4.0E-27
sp|Q9UTB5|PSD2_SCHPO Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd2 PE=3 SV=1 163 297 4.0E-25
sp|B0UWL4|PSD_HISS2 Phosphatidylserine decarboxylase proenzyme OS=Histophilus somni (strain 2336) GN=psd PE=3 SV=1 139 506 4.0E-25
sp|Q3J754|PSD_NITOC Phosphatidylserine decarboxylase proenzyme OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=psd PE=3 SV=1 155 547 2.0E-24
sp|B5F377|PSD_SALA4 Phosphatidylserine decarboxylase proenzyme OS=Salmonella agona (strain SL483) GN=psd PE=3 SV=1 183 539 6.0E-23
sp|Q0AAC1|PSD_ALKEH Phosphatidylserine decarboxylase proenzyme OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=psd PE=3 SV=1 148 501 4.0E-22
sp|Q65RD9|PSD_MANSM Phosphatidylserine decarboxylase proenzyme OS=Mannheimia succiniciproducens (strain MBEL55E) GN=psd PE=3 SV=2 161 512 2.0E-21
sp|B7LC21|PSD_ECO55 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain 55989 / EAEC) GN=psd PE=3 SV=1 183 538 6.0E-21
sp|A1WV88|PSD_HALHL Phosphatidylserine decarboxylase proenzyme OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=psd PE=3 SV=1 188 539 7.0E-21
sp|Q328E0|PSD_SHIDS Phosphatidylserine decarboxylase proenzyme OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=psd PE=3 SV=1 183 538 1.0E-20
sp|Q2YB83|PSD_NITMU Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 356 533 3.0E-20
sp|Q7VYM4|PSD_BORPE Phosphatidylserine decarboxylase proenzyme OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=psd PE=3 SV=1 143 504 4.0E-20
sp|Q7W6I5|PSD_BORPA Phosphatidylserine decarboxylase proenzyme OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=psd PE=3 SV=2 143 504 4.0E-20
sp|Q7WIF7|PSD_BORBR Phosphatidylserine decarboxylase proenzyme OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=psd PE=3 SV=1 143 504 7.0E-20
sp|Q07XV9|PSD_SHEFN Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 356 538 8.0E-20
sp|Q1R397|PSD_ECOUT Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=psd PE=3 SV=1 181 539 8.0E-20
sp|B7MKW7|PSD_ECO45 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=psd PE=3 SV=1 181 539 8.0E-20
sp|B7LLU4|PSD_ESCF3 Phosphatidylserine decarboxylase proenzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=psd PE=3 SV=1 181 539 1.0E-19
sp|B7NTL9|PSD_ECO7I Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=psd PE=3 SV=1 181 539 1.0E-19
sp|B7UPY0|PSD_ECO27 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=psd PE=3 SV=1 181 539 1.0E-19
sp|P0A8K4|PSD_SHIFL Phosphatidylserine decarboxylase proenzyme OS=Shigella flexneri GN=psd PE=3 SV=1 181 538 1.0E-19
sp|Q0SXB9|PSD_SHIF8 Phosphatidylserine decarboxylase proenzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|Q31T93|PSD_SHIBS Phosphatidylserine decarboxylase proenzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B2TY38|PSD_SHIB3 Phosphatidylserine decarboxylase proenzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B1LQI3|PSD_ECOSM Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B6I267|PSD_ECOSE Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain SE11) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B7NG97|PSD_ECOLU Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|P0A8K1|PSD_ECOLI Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12) GN=psd PE=1 SV=1 181 538 1.0E-19
sp|B1IT43|PSD_ECOLC Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|P0A8K2|PSD_ECOL6 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|Q0T9N1|PSD_ECOL5 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B1XDR4|PSD_ECODH Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12 / DH10B) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|C5A1F4|PSD_ECOBW Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B7M8S3|PSD_ECO8A Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O8 (strain IAI1) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B7MSX5|PSD_ECO81 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O81 (strain ED1a) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|B5Z2G9|PSD_ECO5E Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|P0A8K3|PSD_ECO57 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O157:H7 GN=psd PE=3 SV=1 181 538 1.0E-19
sp|A7ZV31|PSD_ECO24 Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=psd PE=3 SV=1 181 538 1.0E-19
sp|Q121P6|PSD_POLSJ Phosphatidylserine decarboxylase proenzyme OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=psd PE=3 SV=1 356 533 2.0E-19
sp|P43789|PSD_HAEIN Phosphatidylserine decarboxylase proenzyme OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=psd PE=3 SV=1 164 534 3.0E-19
sp|Q1D614|PSD_MYXXD Phosphatidylserine decarboxylase proenzyme OS=Myxococcus xanthus (strain DK 1622) GN=psd PE=3 SV=1 149 537 3.0E-19
sp|Q9CJU2|PSD_PASMU Phosphatidylserine decarboxylase proenzyme OS=Pasteurella multocida (strain Pm70) GN=psd PE=3 SV=1 139 505 4.0E-19
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 356 550 4.0E-19
sp|Q87KZ9|PSD_VIBPA Phosphatidylserine decarboxylase proenzyme OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=psd PE=3 SV=1 188 532 5.0E-19
sp|A4YAL8|PSD_SHEPC Phosphatidylserine decarboxylase proenzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=psd PE=3 SV=1 356 508 5.0E-19
sp|A1RFQ8|PSD_SHESW Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain W3-18-1) GN=psd PE=3 SV=1 356 508 5.0E-19
sp|Q4QP27|PSD_HAEI8 Phosphatidylserine decarboxylase proenzyme OS=Haemophilus influenzae (strain 86-028NP) GN=psd PE=3 SV=1 164 534 5.0E-19
sp|Q12J86|PSD_SHEDO Phosphatidylserine decarboxylase proenzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=psd PE=3 SV=1 356 539 5.0E-19
sp|A8H8H5|PSD_SHEPA Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 356 538 5.0E-19
sp|Q0VMD7|PSD_ALCBS Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 143 534 5.0E-19
sp|A3D015|PSD_SHEB5 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=psd PE=3 SV=1 356 538 6.0E-19
sp|B8ECB2|PSD_SHEB2 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS223) GN=psd PE=3 SV=1 356 538 6.0E-19
sp|A9L3W8|PSD_SHEB9 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS195) GN=psd PE=3 SV=1 356 538 6.0E-19
sp|A6WSW1|PSD_SHEB8 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS185) GN=psd PE=3 SV=1 356 538 6.0E-19
sp|Q3YUI0|PSD_SHISS Phosphatidylserine decarboxylase proenzyme OS=Shigella sonnei (strain Ss046) GN=psd PE=3 SV=1 181 538 7.0E-19
sp|A1SA30|PSD_SHEAM Phosphatidylserine decarboxylase proenzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=psd PE=3 SV=1 356 538 9.0E-19
sp|A9C3H8|PSD_DELAS Phosphatidylserine decarboxylase proenzyme OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=psd PE=3 SV=1 355 539 9.0E-19
sp|A1VUQ1|PSD_POLNA Phosphatidylserine decarboxylase proenzyme OS=Polaromonas naphthalenivorans (strain CJ2) GN=psd PE=3 SV=1 345 537 1.0E-18
sp|A3QAD1|PSD_SHELP Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 356 537 1.0E-18
sp|B1KHV8|PSD_SHEWM Phosphatidylserine decarboxylase proenzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=psd PE=3 SV=1 356 538 2.0E-18
sp|Q0HMP8|PSD_SHESM Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-4) GN=psd PE=3 SV=1 356 543 2.0E-18
sp|Q3IFN3|PSD_PSEHT Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=psd PE=3 SV=2 356 502 3.0E-18
sp|C5CU16|PSD_VARPS Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 356 507 3.0E-18
sp|Q0HR33|PSD_SHESR Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 356 504 3.0E-18
sp|A0KSQ8|PSD_SHESA Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 356 504 3.0E-18
sp|B0TU73|PSD_SHEHH Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 356 538 3.0E-18
sp|Q5E2C0|PSD_VIBF1 Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=psd PE=3 SV=1 344 536 4.0E-18
sp|A7MZ50|PSD_VIBCB Phosphatidylserine decarboxylase proenzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=psd PE=3 SV=1 356 532 4.0E-18
sp|A1KBF9|PSD_AZOSB Phosphatidylserine decarboxylase proenzyme OS=Azoarcus sp. (strain BH72) GN=psd PE=3 SV=1 355 534 5.0E-18
sp|A8FRC6|PSD_SHESH Phosphatidylserine decarboxylase proenzyme OS=Shewanella sediminis (strain HAW-EB3) GN=psd PE=3 SV=1 356 538 6.0E-18
sp|B2I1N9|PSD_ACIBC Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 149 535 1.0E-17
sp|B9MAC0|PSD_ACIET Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 356 533 1.0E-17
sp|B0V9W1|PSD_ACIBY Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 149 535 1.0E-17
sp|B7I242|PSD_ACIB5 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 149 535 1.0E-17
sp|B7GUX2|PSD_ACIB3 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 149 535 1.0E-17
sp|Q5ZRA9|PSD_LEGPH Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 356 537 1.0E-17
sp|B5FBS2|PSD_VIBFM Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain MJ11) GN=psd PE=3 SV=1 344 536 1.0E-17
sp|A3MA23|PSD_ACIBT Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 149 535 1.0E-17
sp|Q5QVW0|PSD_IDILO Phosphatidylserine decarboxylase proenzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=psd PE=3 SV=1 344 508 2.0E-17
sp|Q02F61|PSD_PSEAB Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=psd PE=3 SV=1 188 504 2.0E-17
sp|B7V346|PSD_PSEA8 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=psd PE=3 SV=1 188 504 2.0E-17
sp|Q47C25|PSD_DECAR Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 356 534 2.0E-17
sp|Q10949|PISD_CAEEL Phosphatidylserine decarboxylase proenzyme OS=Caenorhabditis elegans GN=psd-1 PE=3 SV=2 148 267 3.0E-17
sp|Q87DS7|PSD_XYLFT Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=psd PE=3 SV=1 188 262 3.0E-17
sp|B2I9I2|PSD_XYLF2 Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M23) GN=psd PE=3 SV=1 188 262 3.0E-17
sp|A2SJL1|PSD_METPP Phosphatidylserine decarboxylase proenzyme OS=Methylibium petroleiphilum (strain PM1) GN=psd PE=3 SV=1 356 533 3.0E-17
sp|Q5X0Q0|PSD_LEGPA Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 356 537 3.0E-17
sp|Q5WSH5|PSD_LEGPL Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 356 537 3.0E-17
sp|A5IIH5|PSD_LEGPC Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 356 537 4.0E-17
sp|Q31H64|PSD_THICR Phosphatidylserine decarboxylase proenzyme OS=Thiomicrospira crunogena (strain XCL-2) GN=psd PE=3 SV=2 357 538 4.0E-17
sp|Q7MGZ5|PSD_VIBVY Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain YJ016) GN=psd PE=3 SV=1 344 532 5.0E-17
sp|Q8DCV8|PSD_VIBVU Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain CMCP6) GN=psd PE=3 SV=1 344 532 5.0E-17
sp|Q9PP76|PSD_CAMJE Phosphatidylserine decarboxylase proenzyme OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=psd PE=3 SV=1 352 534 5.0E-17
sp|Q1GZE8|PSD_METFK Phosphatidylserine decarboxylase proenzyme OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=psd PE=3 SV=1 344 518 6.0E-17
sp|B0VP52|PSD_ACIBS Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain SDF) GN=psd PE=3 SV=1 149 535 6.0E-17
sp|Q9HUK8|PSD_PSEAE Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=psd PE=3 SV=1 188 504 6.0E-17
sp|Q15Q53|PSD_PSEA6 Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=psd PE=3 SV=1 356 505 7.0E-17
sp|Q8P7Q6|PSD_XANCP Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=psd PE=3 SV=1 188 265 7.0E-17
sp|B0RR72|PSD_XANCB Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain B100) GN=psd PE=3 SV=1 188 265 7.0E-17
sp|Q4UWE4|PSD_XANC8 Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain 8004) GN=psd PE=3 SV=1 188 265 7.0E-17
sp|Q2SBA8|PSD_HAHCH Phosphatidylserine decarboxylase proenzyme OS=Hahella chejuensis (strain KCTC 2396) GN=psd PE=3 SV=1 356 536 7.0E-17
sp|Q8PJ17|PSD_XANAC Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas axonopodis pv. citri (strain 306) GN=psd PE=3 SV=1 188 264 9.0E-17
sp|O25911|PSD_HELPY Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=psd PE=3 SV=1 353 534 1.0E-16
sp|Q1CRQ1|PSD_HELPH Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain HPAG1) GN=psd PE=3 SV=1 353 535 1.0E-16
sp|Q6LM21|PSD_PHOPR Phosphatidylserine decarboxylase proenzyme OS=Photobacterium profundum GN=psd PE=3 SV=1 356 539 1.0E-16
sp|B8F658|PSD_HAEPS Phosphatidylserine decarboxylase proenzyme OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=psd PE=3 SV=1 356 537 1.0E-16
sp|B6EMR5|PSD_ALISL Phosphatidylserine decarboxylase proenzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=psd PE=3 SV=1 356 538 2.0E-16
sp|C3LR71|PSD_VIBCM Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain M66-2) GN=psd PE=3 SV=1 356 532 2.0E-16
sp|Q9KV19|PSD_VIBCH Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=psd PE=3 SV=1 356 532 2.0E-16
sp|A5F3N7|PSD_VIBC3 Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=psd PE=3 SV=1 356 532 2.0E-16
sp|C4K3T9|PSD_HAMD5 Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 344 534 2.0E-16
sp|B5Y342|PSD_KLEP3 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae (strain 342) GN=psd PE=3 SV=1 356 542 2.0E-16
sp|Q221E5|PSD_RHOFT Phosphatidylserine decarboxylase proenzyme OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=psd PE=3 SV=2 355 535 3.0E-16
sp|Q9ZJN0|PSD_HELPJ Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=psd PE=3 SV=1 353 535 3.0E-16
sp|B0BR01|PSD_ACTPJ Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=psd PE=3 SV=1 348 536 3.0E-16
sp|B3H2F9|PSD_ACTP7 Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=psd PE=3 SV=1 348 536 3.0E-16
sp|A3N255|PSD_ACTP2 Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=psd PE=3 SV=1 348 536 4.0E-16
sp|B0U6J7|PSD_XYLFM Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M12) GN=psd PE=3 SV=1 188 262 4.0E-16
sp|Q9PDL4|PSD_XYLFA Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain 9a5c) GN=psd PE=3 SV=1 188 262 4.0E-16
sp|Q3BRK2|PSD_XANC5 Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=psd PE=3 SV=1 188 264 7.0E-16
sp|B6JNM7|PSD_HELP2 Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain P12) GN=psd PE=3 SV=1 353 535 8.0E-16
sp|A6VD70|PSD_PSEA7 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain PA7) GN=psd PE=3 SV=1 188 504 1.0E-15
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 356 534 1.0E-15
sp|Q47VZ2|PSD_COLP3 Phosphatidylserine decarboxylase proenzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=psd PE=3 SV=1 356 504 1.0E-15
sp|Q2NW88|PSD_SODGM Phosphatidylserine decarboxylase proenzyme OS=Sodalis glossinidius (strain morsitans) GN=psd PE=3 SV=1 356 504 1.0E-15
sp|B4S0J5|PSD_ALTMD Phosphatidylserine decarboxylase proenzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=psd PE=3 SV=1 356 534 2.0E-15
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 356 536 2.0E-15
sp|B2UVC1|PSD_HELPS Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain Shi470) GN=psd PE=3 SV=1 353 535 2.0E-15
sp|A1SZV9|PSD_PSYIN Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 356 504 2.0E-15
sp|A8AMN8|PSD_CITK8 Phosphatidylserine decarboxylase proenzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=psd PE=3 SV=1 356 538 2.0E-15
sp|B8JBF7|PSD_ANAD2 Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=psd PE=3 SV=1 149 265 3.0E-15
sp|Q1LSP9|PSD_BAUCH Phosphatidylserine decarboxylase proenzyme OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=psd PE=3 SV=1 344 504 3.0E-15
sp|Q83AQ4|PSD_COXBU Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=psd PE=3 SV=1 356 537 4.0E-15
sp|A9NAS0|PSD_COXBR Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=psd PE=3 SV=1 356 537 4.0E-15
sp|B6J316|PSD_COXB2 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuG_Q212) GN=psd PE=3 SV=1 356 537 4.0E-15
sp|B6J9C5|PSD_COXB1 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuK_Q154) GN=psd PE=3 SV=1 356 537 4.0E-15
sp|A9MFQ0|PSD_SALAR Phosphatidylserine decarboxylase proenzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=psd PE=3 SV=1 356 539 4.0E-15
sp|A9KEZ8|PSD_COXBN Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=psd PE=3 SV=1 356 537 4.0E-15
sp|C1DLP2|PSD_AZOVD Phosphatidylserine decarboxylase proenzyme OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=psd PE=3 SV=1 155 265 5.0E-15
sp|B4UEL4|PSD_ANASK Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter sp. (strain K) GN=psd PE=3 SV=1 149 265 7.0E-15
sp|Q7MYS6|PSD_PHOLL Phosphatidylserine decarboxylase proenzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psd PE=3 SV=1 356 550 8.0E-15
sp|Q4KJ87|PSD_PSEF5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 155 262 8.0E-15
sp|B4SQW4|PSD_STRM5 Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain R551-3) GN=psd PE=3 SV=1 188 263 8.0E-15
sp|C0Q6C0|PSD_SALPC Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi C (strain RKS4594) GN=psd PE=3 SV=1 356 538 9.0E-15
sp|A1JIQ6|PSD_YERE8 Phosphatidylserine decarboxylase proenzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=psd PE=3 SV=1 356 504 9.0E-15
sp|Q8ZKB1|PSD_SALTY Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B4TSE2|PSD_SALSV Phosphatidylserine decarboxylase proenzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B5BKH1|PSD_SALPK Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|A9N419|PSD_SALPB Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|Q5PLG9|PSD_SALPA Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B4T2Q7|PSD_SALNS Phosphatidylserine decarboxylase proenzyme OS=Salmonella newport (strain SL254) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B4TF96|PSD_SALHS Phosphatidylserine decarboxylase proenzyme OS=Salmonella heidelberg (strain SL476) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B5R9A9|PSD_SALG2 Phosphatidylserine decarboxylase proenzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B5R023|PSD_SALEP Phosphatidylserine decarboxylase proenzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|B5FRL8|PSD_SALDC Phosphatidylserine decarboxylase proenzyme OS=Salmonella dublin (strain CT_02021853) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|Q57GM9|PSD_SALCH Phosphatidylserine decarboxylase proenzyme OS=Salmonella choleraesuis (strain SC-B67) GN=psd PE=3 SV=1 356 538 1.0E-14
sp|A7MMA5|PSD_CROS8 Phosphatidylserine decarboxylase proenzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=psd PE=3 SV=1 356 533 1.0E-14
sp|B1JMP9|PSD_YERPY Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|Q66FC4|PSD_YERPS Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|A4TRP9|PSD_YERPP Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis (strain Pestoides F) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|Q1CEE6|PSD_YERPN Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|A9QYP0|PSD_YERPG Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Angola) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|Q8ZIX1|PSD_YERPE Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis GN=psd PE=3 SV=1 356 504 1.0E-14
sp|B2K1Z5|PSD_YERPB Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|Q1C0Z1|PSD_YERPA Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|A7FMY9|PSD_YERP3 Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=psd PE=3 SV=1 356 504 1.0E-14
sp|Q5GXQ3|PSD_XANOR Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=psd PE=3 SV=1 188 262 1.0E-14
sp|Q8Z194|PSD_SALTI Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhi GN=psd PE=3 SV=1 356 538 1.0E-14
sp|Q2P0T0|PSD_XANOM Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=psd PE=3 SV=1 188 262 1.0E-14
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 356 535 2.0E-14
sp|A8A7Q7|PSD_ECOHS Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O9:H4 (strain HS) GN=psd PE=3 SV=1 356 538 2.0E-14
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 356 534 2.0E-14
sp|Q88DB9|PSD_PSEPK Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 155 262 2.0E-14
sp|A5W9U4|PSD_PSEP1 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 155 262 2.0E-14
sp|B2FP04|PSD_STRMK Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain K279a) GN=psd PE=3 SV=1 188 262 3.0E-14
sp|Q6D035|PSD_PECAS Phosphatidylserine decarboxylase proenzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=psd PE=3 SV=1 356 506 3.0E-14
sp|A6TH77|PSD_KLEP7 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=psd PE=3 SV=1 356 532 4.0E-14
sp|Q9EV04|PSD_DICD3 Phosphatidylserine decarboxylase proenzyme OS=Dickeya dadantii (strain 3937) GN=psd PE=3 SV=2 356 504 5.0E-14
sp|Q1I433|PSD_PSEE4 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 188 262 9.0E-14
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 154 262 1.0E-13
sp|B0KL10|PSD_PSEPG Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 188 262 1.0E-13
sp|A1WIF0|PSD_VEREI Phosphatidylserine decarboxylase proenzyme OS=Verminephrobacter eiseniae (strain EF01-2) GN=psd PE=3 SV=1 355 504 1.0E-13
sp|Q31H64|PSD_THICR Phosphatidylserine decarboxylase proenzyme OS=Thiomicrospira crunogena (strain XCL-2) GN=psd PE=3 SV=2 146 284 2.0E-13
sp|A7MMA5|PSD_CROS8 Phosphatidylserine decarboxylase proenzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=psd PE=3 SV=1 181 262 2.0E-13
sp|Q2L0K8|PSD_BORA1 Phosphatidylserine decarboxylase proenzyme OS=Bordetella avium (strain 197N) GN=psd PE=3 SV=1 356 504 2.0E-13
sp|A4XPX3|PSD_PSEMY Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 155 262 2.0E-13
sp|B2VCV2|PSD_ERWT9 Phosphatidylserine decarboxylase proenzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=psd PE=3 SV=1 356 504 2.0E-13
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 356 535 3.0E-13
sp|Q9EV04|PSD_DICD3 Phosphatidylserine decarboxylase proenzyme OS=Dickeya dadantii (strain 3937) GN=psd PE=3 SV=2 181 262 4.0E-13
sp|Q1QUI2|PSD_CHRSD Phosphatidylserine decarboxylase proenzyme OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=psd PE=3 SV=1 356 534 4.0E-13
sp|Q7VNA7|PSD_HAEDU Phosphatidylserine decarboxylase proenzyme OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=psd PE=3 SV=1 356 504 4.0E-13
sp|C3KDM6|PSD_PSEFS Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 147 262 5.0E-13
sp|B1JAE9|PSD_PSEPW Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 188 262 7.0E-13
sp|A9IM91|PSD_BORPD Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 356 504 8.0E-13
sp|Q83AQ4|PSD_COXBU Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=psd PE=3 SV=1 161 263 9.0E-13
sp|A9NAS0|PSD_COXBR Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=psd PE=3 SV=1 161 263 9.0E-13
sp|B6J316|PSD_COXB2 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuG_Q212) GN=psd PE=3 SV=1 161 263 9.0E-13
sp|B6J9C5|PSD_COXB1 Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain CbuK_Q154) GN=psd PE=3 SV=1 161 263 9.0E-13
sp|Q2NW88|PSD_SODGM Phosphatidylserine decarboxylase proenzyme OS=Sodalis glossinidius (strain morsitans) GN=psd PE=3 SV=1 183 261 1.0E-12
sp|Q4KJ87|PSD_PSEF5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 356 534 1.0E-12
sp|Q3KJ03|PSD_PSEPF Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 155 262 1.0E-12
sp|Q493W4|PSD_BLOPB Phosphatidylserine decarboxylase proenzyme OS=Blochmannia pennsylvanicus (strain BPEN) GN=psd PE=3 SV=1 356 512 1.0E-12
sp|Q608T0|PSD_METCA Phosphatidylserine decarboxylase proenzyme OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=psd PE=3 SV=1 333 534 1.0E-12
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 149 262 2.0E-12
sp|A9KEZ8|PSD_COXBN Phosphatidylserine decarboxylase proenzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=psd PE=3 SV=1 161 263 2.0E-12
sp|B4UEL4|PSD_ANASK Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter sp. (strain K) GN=psd PE=3 SV=1 356 534 2.0E-12
sp|B8JBF7|PSD_ANAD2 Phosphatidylserine decarboxylase proenzyme OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=psd PE=3 SV=1 356 534 3.0E-12
sp|A8A7Q7|PSD_ECOHS Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli O9:H4 (strain HS) GN=psd PE=3 SV=1 183 262 4.0E-12
sp|Q88DB9|PSD_PSEPK Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 356 539 4.0E-12
sp|A9MFQ0|PSD_SALAR Phosphatidylserine decarboxylase proenzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=psd PE=3 SV=1 181 262 5.0E-12
sp|C0Q6C0|PSD_SALPC Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi C (strain RKS4594) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|Q8ZKB1|PSD_SALTY Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B4TSE2|PSD_SALSV Phosphatidylserine decarboxylase proenzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B5BKH1|PSD_SALPK Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|A9N419|PSD_SALPB Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|Q5PLG9|PSD_SALPA Phosphatidylserine decarboxylase proenzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B4T2Q7|PSD_SALNS Phosphatidylserine decarboxylase proenzyme OS=Salmonella newport (strain SL254) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B4TF96|PSD_SALHS Phosphatidylserine decarboxylase proenzyme OS=Salmonella heidelberg (strain SL476) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B5R9A9|PSD_SALG2 Phosphatidylserine decarboxylase proenzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B5R023|PSD_SALEP Phosphatidylserine decarboxylase proenzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B5FRL8|PSD_SALDC Phosphatidylserine decarboxylase proenzyme OS=Salmonella dublin (strain CT_02021853) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|Q57GM9|PSD_SALCH Phosphatidylserine decarboxylase proenzyme OS=Salmonella choleraesuis (strain SC-B67) GN=psd PE=3 SV=1 183 262 5.0E-12
sp|Q8Z194|PSD_SALTI Phosphatidylserine decarboxylase proenzyme OS=Salmonella typhi GN=psd PE=3 SV=1 183 262 5.0E-12
sp|B0KL10|PSD_PSEPG Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 356 539 5.0E-12
sp|A9L3W8|PSD_SHEB9 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS195) GN=psd PE=3 SV=1 148 264 6.0E-12
sp|A6WSW1|PSD_SHEB8 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS185) GN=psd PE=3 SV=1 148 264 6.0E-12
sp|B2VCV2|PSD_ERWT9 Phosphatidylserine decarboxylase proenzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=psd PE=3 SV=1 155 261 6.0E-12
sp|A3D015|PSD_SHEB5 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=psd PE=3 SV=1 148 264 7.0E-12
sp|B8ECB2|PSD_SHEB2 Phosphatidylserine decarboxylase proenzyme OS=Shewanella baltica (strain OS223) GN=psd PE=3 SV=1 148 264 7.0E-12
sp|A5W9U4|PSD_PSEP1 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 356 534 8.0E-12
sp|A4XPX3|PSD_PSEMY Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 356 534 8.0E-12
sp|A1JIQ6|PSD_YERE8 Phosphatidylserine decarboxylase proenzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=psd PE=3 SV=1 148 261 9.0E-12
sp|Q07XV9|PSD_SHEFN Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 148 262 1.0E-11
sp|A1SA30|PSD_SHEAM Phosphatidylserine decarboxylase proenzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=psd PE=3 SV=1 148 262 1.0E-11
sp|B5Y342|PSD_KLEP3 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae (strain 342) GN=psd PE=3 SV=1 181 262 1.0E-11
sp|A6TH77|PSD_KLEP7 Phosphatidylserine decarboxylase proenzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=psd PE=3 SV=1 181 262 1.0E-11
sp|C0Z4E2|PSD_BREBN Phosphatidylserine decarboxylase proenzyme OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psd PE=3 SV=1 356 533 1.0E-11
sp|Q121P6|PSD_POLSJ Phosphatidylserine decarboxylase proenzyme OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=psd PE=3 SV=1 188 262 2.0E-11
sp|Q8P7Q6|PSD_XANCP Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=psd PE=3 SV=1 356 535 2.0E-11
sp|B0RR72|PSD_XANCB Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain B100) GN=psd PE=3 SV=1 356 535 2.0E-11
sp|Q4UWE4|PSD_XANC8 Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. campestris (strain 8004) GN=psd PE=3 SV=1 356 535 2.0E-11
sp|Q1I433|PSD_PSEE4 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 356 539 2.0E-11
sp|A9IM91|PSD_BORPD Phosphatidylserine decarboxylase proenzyme OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=psd PE=3 SV=1 156 262 2.0E-11
sp|Q3KJ03|PSD_PSEPF Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 356 535 2.0E-11
sp|Q6D035|PSD_PECAS Phosphatidylserine decarboxylase proenzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=psd PE=3 SV=1 165 262 3.0E-11
sp|C5CU16|PSD_VARPS Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 188 262 4.0E-11
sp|Q7P0H6|PSD_CHRVO Phosphatidylserine decarboxylase proenzyme OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=psd PE=3 SV=1 355 533 4.0E-11
sp|Q5QVW0|PSD_IDILO Phosphatidylserine decarboxylase proenzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=psd PE=3 SV=1 142 262 5.0E-11
sp|A8AMN8|PSD_CITK8 Phosphatidylserine decarboxylase proenzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=psd PE=3 SV=1 183 262 5.0E-11
sp|Q5GXQ3|PSD_XANOR Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=psd PE=3 SV=1 356 527 6.0E-11
sp|Q5E2C0|PSD_VIBF1 Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=psd PE=3 SV=1 156 262 7.0E-11
sp|Q2P0T0|PSD_XANOM Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=psd PE=3 SV=1 356 527 7.0E-11
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 149 262 9.0E-11
sp|C3KDM6|PSD_PSEFS Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 356 531 9.0E-11
sp|B5FBS2|PSD_VIBFM Phosphatidylserine decarboxylase proenzyme OS=Vibrio fischeri (strain MJ11) GN=psd PE=3 SV=1 156 262 1.0E-10
sp|B1JMP9|PSD_YERPY Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|Q66FC4|PSD_YERPS Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|A4TRP9|PSD_YERPP Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis (strain Pestoides F) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|Q1CEE6|PSD_YERPN Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|A9QYP0|PSD_YERPG Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Angola) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|Q8ZIX1|PSD_YERPE Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis GN=psd PE=3 SV=1 148 261 1.0E-10
sp|B2K1Z5|PSD_YERPB Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|Q1C0Z1|PSD_YERPA Phosphatidylserine decarboxylase proenzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|A7FMY9|PSD_YERP3 Phosphatidylserine decarboxylase proenzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=psd PE=3 SV=1 148 261 1.0E-10
sp|B1JAE9|PSD_PSEPW Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 356 534 1.0E-10
sp|B2SFB2|PSD_FRATM Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=psd PE=3 SV=1 143 262 1.0E-10
sp|B0TU73|PSD_SHEHH Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 148 264 2.0E-10
sp|Q1GZE8|PSD_METFK Phosphatidylserine decarboxylase proenzyme OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=psd PE=3 SV=1 149 262 2.0E-10
sp|Q2SBA8|PSD_HAHCH Phosphatidylserine decarboxylase proenzyme OS=Hahella chejuensis (strain KCTC 2396) GN=psd PE=3 SV=1 156 262 2.0E-10
sp|Q3BRK2|PSD_XANC5 Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=psd PE=3 SV=1 356 531 2.0E-10
sp|B4SQW4|PSD_STRM5 Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain R551-3) GN=psd PE=3 SV=1 344 527 2.0E-10
sp|B2FP04|PSD_STRMK Phosphatidylserine decarboxylase proenzyme OS=Stenotrophomonas maltophilia (strain K279a) GN=psd PE=3 SV=1 344 527 2.0E-10
sp|A1WIF0|PSD_VEREI Phosphatidylserine decarboxylase proenzyme OS=Verminephrobacter eiseniae (strain EF01-2) GN=psd PE=3 SV=1 188 278 2.0E-10
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 188 262 3.0E-10
sp|A4IZN0|PSD_FRATW Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=psd PE=3 SV=1 143 262 3.0E-10
sp|Q5NHR3|PSD_FRATT Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=psd PE=3 SV=2 143 262 3.0E-10
sp|Q0BN99|PSD_FRATO Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=psd PE=3 SV=1 143 262 3.0E-10
sp|Q2A4Y0|PSD_FRATH Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain LVS) GN=psd PE=3 SV=1 143 262 3.0E-10
sp|A7NAF0|PSD_FRATF Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=psd PE=3 SV=1 143 262 3.0E-10
sp|Q14J65|PSD_FRAT1 Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=psd PE=3 SV=1 143 262 3.0E-10
sp|Q87DS7|PSD_XYLFT Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=psd PE=3 SV=1 347 543 4.0E-10
sp|B2I9I2|PSD_XYLF2 Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M23) GN=psd PE=3 SV=1 347 543 4.0E-10
sp|Q8PJ17|PSD_XANAC Phosphatidylserine decarboxylase proenzyme OS=Xanthomonas axonopodis pv. citri (strain 306) GN=psd PE=3 SV=1 356 531 4.0E-10
sp|B6EMR5|PSD_ALISL Phosphatidylserine decarboxylase proenzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=psd PE=3 SV=1 156 262 4.0E-10
sp|Q1LSP9|PSD_BAUCH Phosphatidylserine decarboxylase proenzyme OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=psd PE=3 SV=1 182 265 4.0E-10
sp|Q2L0K8|PSD_BORA1 Phosphatidylserine decarboxylase proenzyme OS=Bordetella avium (strain 197N) GN=psd PE=3 SV=1 177 262 4.0E-10
sp|B0TZM7|PSD_FRAP2 Phosphatidylserine decarboxylase proenzyme OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=psd PE=3 SV=1 188 262 4.0E-10
sp|Q24UV7|PSD_DESHY Phosphatidylserine decarboxylase proenzyme OS=Desulfitobacterium hafniense (strain Y51) GN=psd PE=3 SV=1 182 261 5.0E-10
sp|A8FRC6|PSD_SHESH Phosphatidylserine decarboxylase proenzyme OS=Shewanella sediminis (strain HAW-EB3) GN=psd PE=3 SV=1 148 264 6.0E-10
sp|A4YAL8|PSD_SHEPC Phosphatidylserine decarboxylase proenzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=psd PE=3 SV=1 148 284 7.0E-10
sp|B9MAC0|PSD_ACIET Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 188 262 7.0E-10
sp|B8FQ96|PSD_DESHD Phosphatidylserine decarboxylase proenzyme OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=psd PE=3 SV=1 177 261 7.0E-10
sp|A0Q562|PSD_FRATN Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. novicida (strain U112) GN=psd PE=3 SV=1 188 262 7.0E-10
sp|Q0HMP8|PSD_SHESM Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-4) GN=psd PE=3 SV=1 148 264 8.0E-10
sp|Q0HR33|PSD_SHESR Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 148 264 8.0E-10
sp|B0U6J7|PSD_XYLFM Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain M12) GN=psd PE=3 SV=1 347 543 8.0E-10
sp|Q47VZ2|PSD_COLP3 Phosphatidylserine decarboxylase proenzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=psd PE=3 SV=1 148 268 8.0E-10
sp|A0KSQ8|PSD_SHESA Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 148 264 9.0E-10
sp|Q493W4|PSD_BLOPB Phosphatidylserine decarboxylase proenzyme OS=Blochmannia pennsylvanicus (strain BPEN) GN=psd PE=3 SV=1 183 262 9.0E-10
sp|Q0TV39|PSD_CLOP1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 158 261 9.0E-10
sp|Q3IFN3|PSD_PSEHT Phosphatidylserine decarboxylase proenzyme OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=psd PE=3 SV=2 148 262 1.0E-09
sp|Q8D2C6|PSD_WIGBR Phosphatidylserine decarboxylase proenzyme OS=Wigglesworthia glossinidia brevipalpis GN=psd PE=3 SV=1 356 504 1.0E-09
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 357 510 1.0E-09
sp|B2UX63|PSD_CLOBA Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=psd PE=3 SV=1 158 261 1.0E-09
sp|Q8XPD5|PSD_CLOPE Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain 13 / Type A) GN=psd PE=3 SV=1 158 261 1.0E-09
sp|A8H8H5|PSD_SHEPA Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 148 264 2.0E-09
sp|A9C3H8|PSD_DELAS Phosphatidylserine decarboxylase proenzyme OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=psd PE=3 SV=1 155 262 2.0E-09
sp|C4K3T9|PSD_HAMD5 Phosphatidylserine decarboxylase proenzyme OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=psd PE=3 SV=1 148 265 2.0E-09
sp|Q7VQP8|PSD_BLOFL Phosphatidylserine decarboxylase proenzyme OS=Blochmannia floridanus GN=psd PE=3 SV=1 183 262 2.0E-09
sp|A1RFQ8|PSD_SHESW Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain W3-18-1) GN=psd PE=3 SV=1 148 264 3.0E-09
sp|Q7MYS6|PSD_PHOLL Phosphatidylserine decarboxylase proenzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psd PE=3 SV=1 148 262 3.0E-09
sp|C0Z4E2|PSD_BREBN Phosphatidylserine decarboxylase proenzyme OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psd PE=3 SV=1 151 262 3.0E-09
sp|B0TZM7|PSD_FRAP2 Phosphatidylserine decarboxylase proenzyme OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=psd PE=3 SV=1 336 503 3.0E-09
sp|Q8D2C6|PSD_WIGBR Phosphatidylserine decarboxylase proenzyme OS=Wigglesworthia glossinidia brevipalpis GN=psd PE=3 SV=1 155 263 3.0E-09
sp|B7GKA2|PSD_ANOFW Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 184 262 3.0E-09
sp|Q9PDL4|PSD_XYLFA Phosphatidylserine decarboxylase proenzyme OS=Xylella fastidiosa (strain 9a5c) GN=psd PE=3 SV=1 356 543 4.0E-09
sp|A1VUQ1|PSD_POLNA Phosphatidylserine decarboxylase proenzyme OS=Polaromonas naphthalenivorans (strain CJ2) GN=psd PE=3 SV=1 190 262 5.0E-09
sp|C3LR71|PSD_VIBCM Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain M66-2) GN=psd PE=3 SV=1 188 262 5.0E-09
sp|Q9KV19|PSD_VIBCH Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=psd PE=3 SV=1 188 262 5.0E-09
sp|A5F3N7|PSD_VIBC3 Phosphatidylserine decarboxylase proenzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=psd PE=3 SV=1 188 262 5.0E-09
sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 158 261 5.0E-09
sp|P0CD79|PSD_CHLTR Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=psd PE=3 SV=1 357 436 5.0E-09
sp|Q3KKZ5|PSD_CHLTA Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=psd PE=3 SV=1 357 436 5.0E-09
sp|B0B8S5|PSD_CHLT2 Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=psd PE=3 SV=1 357 436 5.0E-09
sp|B0BAF4|PSD_CHLTB Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=psd PE=3 SV=1 357 436 5.0E-09
sp|B1KHV8|PSD_SHEWM Phosphatidylserine decarboxylase proenzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=psd PE=3 SV=1 148 264 6.0E-09
sp|A2SJL1|PSD_METPP Phosphatidylserine decarboxylase proenzyme OS=Methylibium petroleiphilum (strain PM1) GN=psd PE=3 SV=1 190 262 6.0E-09
sp|Q7P0H6|PSD_CHRVO Phosphatidylserine decarboxylase proenzyme OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=psd PE=3 SV=1 155 261 7.0E-09
sp|Q1QUI2|PSD_CHRSD Phosphatidylserine decarboxylase proenzyme OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=psd PE=3 SV=1 155 262 8.0E-09
sp|A3QAD1|PSD_SHELP Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 148 264 9.0E-09
sp|Q12J86|PSD_SHEDO Phosphatidylserine decarboxylase proenzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=psd PE=3 SV=1 188 262 1.0E-08
sp|B8F658|PSD_HAEPS Phosphatidylserine decarboxylase proenzyme OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=psd PE=3 SV=1 162 262 1.0E-08
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 149 262 1.0E-08
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 149 262 1.0E-08
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 357 508 1.0E-08
sp|A0Q562|PSD_FRATN Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. novicida (strain U112) GN=psd PE=3 SV=1 344 538 2.0E-08
sp|A7GT32|PSD_BACCN Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 166 264 2.0E-08
sp|A6LPC8|PSD_CLOB8 Phosphatidylserine decarboxylase proenzyme OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=psd PE=3 SV=1 158 262 2.0E-08
sp|Q47C25|PSD_DECAR Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 188 262 3.0E-08
sp|B4S0J5|PSD_ALTMD Phosphatidylserine decarboxylase proenzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=psd PE=3 SV=1 148 264 3.0E-08
sp|Q7VQP8|PSD_BLOFL Phosphatidylserine decarboxylase proenzyme OS=Blochmannia floridanus GN=psd PE=3 SV=1 356 505 3.0E-08
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 190 261 3.0E-08
sp|Q6HDI5|PSD_BACHK Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=psd PE=3 SV=1 166 264 3.0E-08
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 158 261 3.0E-08
sp|B2THF2|PSD_CLOBB Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=psd PE=3 SV=1 158 261 3.0E-08
sp|B2SFB2|PSD_FRATM Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=psd PE=3 SV=1 336 538 4.0E-08
sp|A4IZN0|PSD_FRATW Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=psd PE=3 SV=1 336 538 4.0E-08
sp|Q5NHR3|PSD_FRATT Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=psd PE=3 SV=2 336 538 4.0E-08
sp|Q0BN99|PSD_FRATO Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=psd PE=3 SV=1 336 538 4.0E-08
sp|Q2A4Y0|PSD_FRATH Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain LVS) GN=psd PE=3 SV=1 336 538 4.0E-08
sp|A7NAF0|PSD_FRATF Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=psd PE=3 SV=1 336 538 4.0E-08
sp|Q14J65|PSD_FRAT1 Phosphatidylserine decarboxylase proenzyme OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=psd PE=3 SV=1 336 538 4.0E-08
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 357 508 5.0E-08
sp|Q221E5|PSD_RHOFT Phosphatidylserine decarboxylase proenzyme OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=psd PE=3 SV=2 188 278 6.0E-08
sp|B0BR01|PSD_ACTPJ Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=psd PE=3 SV=1 139 262 6.0E-08
sp|B3H2F9|PSD_ACTP7 Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=psd PE=3 SV=1 139 262 6.0E-08
sp|A3N255|PSD_ACTP2 Phosphatidylserine decarboxylase proenzyme OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=psd PE=3 SV=1 139 262 6.0E-08
sp|C5D4W6|PSD_GEOSW Phosphatidylserine decarboxylase proenzyme OS=Geobacillus sp. (strain WCH70) GN=psd PE=3 SV=1 166 262 6.0E-08
sp|B2UVC1|PSD_HELPS Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain Shi470) GN=psd PE=3 SV=1 159 266 7.0E-08
sp|Q608T0|PSD_METCA Phosphatidylserine decarboxylase proenzyme OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=psd PE=3 SV=1 150 262 7.0E-08
sp|C1ESN2|PSD_BACC3 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain 03BB102) GN=psd PE=3 SV=1 166 264 7.0E-08
sp|A0RIV4|PSD_BACAH Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis (strain Al Hakam) GN=psd PE=3 SV=1 166 264 7.0E-08
sp|Q5ZRA9|PSD_LEGPH Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 155 262 8.0E-08
sp|Q5WSH5|PSD_LEGPL Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 155 262 9.0E-08
sp|A5IIH5|PSD_LEGPC Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 155 262 9.0E-08
sp|Q5X0Q0|PSD_LEGPA Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 155 262 1.0E-07
sp|A7MZ50|PSD_VIBCB Phosphatidylserine decarboxylase proenzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=psd PE=3 SV=1 188 262 2.0E-07
sp|A1KBF9|PSD_AZOSB Phosphatidylserine decarboxylase proenzyme OS=Azoarcus sp. (strain BH72) GN=psd PE=3 SV=1 188 262 2.0E-07
sp|Q9ZJN0|PSD_HELPJ Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=psd PE=3 SV=1 159 266 2.0E-07
sp|B6JNM7|PSD_HELP2 Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain P12) GN=psd PE=3 SV=1 159 266 2.0E-07
sp|P53037|PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 358 432 2.0E-07
sp|Q5KWX3|PSD_GEOKA Phosphatidylserine decarboxylase proenzyme OS=Geobacillus kaustophilus (strain HTA426) GN=psd PE=3 SV=1 184 262 2.0E-07
sp|Q9Z767|PSD_CHLPN Phosphatidylserine decarboxylase proenzyme OS=Chlamydia pneumoniae GN=psd PE=3 SV=1 344 436 2.0E-07
sp|Q818C6|PSD_BACCR Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 166 264 3.0E-07
sp|B7HCW5|PSD_BACC4 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 166 264 3.0E-07
sp|Q81LP7|PSD_BACAN Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis GN=psd PE=3 SV=1 166 264 3.0E-07
sp|C3L5U2|PSD_BACAC Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=psd PE=3 SV=1 166 264 3.0E-07
sp|C3P929|PSD_BACAA Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain A0248) GN=psd PE=3 SV=1 166 264 3.0E-07
sp|B7IYJ1|PSD_BACC2 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain G9842) GN=psd PE=3 SV=1 166 264 3.0E-07
sp|Q7MGZ5|PSD_VIBVY Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain YJ016) GN=psd PE=3 SV=1 188 262 4.0E-07
sp|Q8DCV8|PSD_VIBVU Phosphatidylserine decarboxylase proenzyme OS=Vibrio vulnificus (strain CMCP6) GN=psd PE=3 SV=1 188 262 4.0E-07
sp|O25911|PSD_HELPY Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=psd PE=3 SV=1 159 266 4.0E-07
sp|Q1CRQ1|PSD_HELPH Phosphatidylserine decarboxylase proenzyme OS=Helicobacter pylori (strain HPAG1) GN=psd PE=3 SV=1 159 266 4.0E-07
sp|Q6LM21|PSD_PHOPR Phosphatidylserine decarboxylase proenzyme OS=Photobacterium profundum GN=psd PE=3 SV=1 148 262 4.0E-07
sp|B7HPN7|PSD_BACC7 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH187) GN=psd PE=3 SV=1 166 264 4.0E-07
sp|B7JNX0|PSD_BACC0 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH820) GN=psd PE=3 SV=1 166 264 4.0E-07
sp|Q634K5|PSD_BACCZ Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ZK / E33L) GN=psd PE=3 SV=1 166 264 4.0E-07
sp|Q2YB83|PSD_NITMU Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 188 265 5.0E-07
sp|Q730J7|PSD_BACC1 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 166 264 5.0E-07
sp|A9VHW5|PSD_BACWK Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 166 264 5.0E-07
sp|Q9PLM7|PSD_CHLMU Phosphatidylserine decarboxylase proenzyme OS=Chlamydia muridarum (strain MoPn / Nigg) GN=psd PE=3 SV=1 357 436 7.0E-07
sp|A1SZV9|PSD_PSYIN Phosphatidylserine decarboxylase proenzyme OS=Psychromonas ingrahamii (strain 37) GN=psd PE=3 SV=1 155 262 8.0E-07
sp|Q9KDA3|PSD_BACHD Phosphatidylserine decarboxylase proenzyme OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=psd PE=3 SV=1 172 264 8.0E-07
sp|Q7VNA7|PSD_HAEDU Phosphatidylserine decarboxylase proenzyme OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=psd PE=3 SV=1 164 263 1.0E-06
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 182 264 1.0E-06
sp|A7G9C7|PSD_CLOBL Phosphatidylserine decarboxylase proenzyme OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psd PE=3 SV=1 158 262 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008654 phospholipid biosynthetic process Yes
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0016830 carbon-carbon lyase activity No
GO:0016831 carboxy-lyase activity No
GO:0006644 phospholipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0016829 lyase activity No
GO:0006793 phosphorus metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0019637 organophosphate metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5973
MNAVIGAGPCPLLRRRVLAAVHRPCPGCASPNVRSTTDAGFRGLRQMFGARRSYVSDAGKRPRFSKRLGEALRRS
RIQWYQIPVGLGVAFLGVLQINKVISRELETDAAQQKQRPKARPEGPWHVNPRRRASSAVCILWNKADTRFRQVQ
VMSTLPLKAISRLWGRFNELTIPYYLRVPGFKLYSFIFGVNLDEVSEPDLHVYPNLAAFFYRTLKPGVRPLDPDP
NALLSPSDGKVLQFGRIEGGDIEQVKGMTYSIDALLGKKTPPPSIQSSSDDSHGDEAIVKQEEEFAQVNGISYTL
PDLLTGPKSTKPRQAVTDESTEASPRAVSEVRADLALGERPWYEALSANETTALYYAVVYLAPGDYHRFHSPTNW
VVERRRHFPGELFSVSPYLQRTLPGLFTLNERVVLIGRWRHGFFSYTPVGATNVGSIRVNFDRELRTNSLTTDTA
ADQAAAEAAKRGESYLDYVEATYEGASAVLRGHALRRGEEMGGFQLGSTVVLVFEAPADKRAGAPGWEWCVEKGQ
KVKMGQPLGRVSEAGTGEASTKKIS*
Coding >Ophun1|5973
ATGAACGCCGTCATCGGAGCCGGCCCCTGTCCGCTCCTTCGACGCCGCGTTCTCGCAGCTGTCCACAGGCCATGT
CCAGGATGCGCATCTCCCAATGTCAGGTCAACAACGGATGCCGGCTTTCGGGGCCTCCGGCAGATGTTTGGCGCG
CGAAGAAGCTATGTCTCCGACGCTGGCAAGCGGCCACGCTTCTCCAAACGTCTCGGCGAGGCCCTTCGCCGCAGT
AGGATCCAATGGTATCAAATTCCCGTCGGTCTCGGCGTAGCCTTCCTCGGCGTCTTGCAGATCAACAAGGTCATC
TCGAGAGAGCTGGAGACCGATGCGGCACAGCAAAAGCAGCGGCCCAAGGCGCGGCCTGAAGGACCATGGCATGTC
AACCCACGCCGCAGAGCATCATCGGCGGTCTGCATTCTATGGAACAAAGCTGACACTCGCTTCAGGCAAGTTCAG
GTCATGTCGACTCTGCCGCTCAAGGCCATCTCTCGGCTCTGGGGTCGGTTCAACGAGCTGACGATTCCCTACTAC
CTGCGCGTCCCTGGCTTCAAGCTATACTCGTTCATCTTTGGCGTCAACCTCGACGAGGTCTCCGAGCCAGATCTC
CACGTCTATCCCAATCTAGCCGCCTTTTTCTACCGCACTCTCAAACCGGGTGTTCGACCATTGGATCCAGATCCA
AACGCTCTGCTCTCACCGTCGGATGGCAAGGTTCTCCAGTTCGGTCGAATCGAGGGCGGCGACATTGAGCAGGTC
AAAGGGATGACGTACAGCATCGACGCGTTACTTGGCAAGAAAACACCGCCTCCCAGCATACAAAGCTCCAGCGAC
GATTCGCACGGCGATGAAGCCATTGTCAAGCAGGAAGAGGAATTCGCCCAGGTCAACGGCATCTCCTACACGCTC
CCCGACCTCCTGACAGGGCCGAAAAGCACCAAGCCTCGACAGGCGGTGACGGACGAGTCGACCGAGGCATCGCCG
CGGGCCGTATCCGAAGTCCGGGCGGATCTGGCCCTCGGCGAGCGGCCATGGTACGAAGCACTCTCCGCCAACGAG
ACGACAGCGCTCTACTACGCCGTAGTTTACCTGGCGCCCGGCGACTACCATCGCTTCCACTCGCCGACCAATTGG
GTCGTCGAGCGACGGCGACACTTCCCAGGCGAGCTGTTCAGTGTATCGCCCTACCTCCAGCGGACGCTACCTGGC
CTCTTCACGCTCAACGAGCGCGTGGTGCTAATCGGCCGCTGGCGACACGGCTTCTTTAGCTACACCCCCGTCGGT
GCCACCAACGTCGGCTCCATCCGCGTCAACTTCGACCGCGAACTGCGAACAAATAGCCTCACGACGGACACGGCG
GCCGATCAGGCGGCAGCTGAGGCGGCCAAGCGAGGGGAGTCTTACCTCGACTACGTTGAGGCGACGTACGAGGGG
GCCAGCGCCGTGCTGCGAGGCCATGCGCTGCGCAGGGGAGAGGAGATGGGCGGATTCCAGCTGGGCAGCACCGTC
GTCCTCGTCTTCGAGGCTCCGGCCGATAAACGCGCTGGGGCACCGGGCTGGGAGTGGTGTGTGGAAAAGGGGCAG
AAGGTGAAGATGGGACAGCCGCTGGGGCGGGTTTCCGAGGCTGGGACGGGAGAGGCCTCGACGAAGAAGATCAGC
TGA
Transcript >Ophun1|5973
ATGAACGCCGTCATCGGAGCCGGCCCCTGTCCGCTCCTTCGACGCCGCGTTCTCGCAGCTGTCCACAGGCCATGT
CCAGGATGCGCATCTCCCAATGTCAGGTCAACAACGGATGCCGGCTTTCGGGGCCTCCGGCAGATGTTTGGCGCG
CGAAGAAGCTATGTCTCCGACGCTGGCAAGCGGCCACGCTTCTCCAAACGTCTCGGCGAGGCCCTTCGCCGCAGT
AGGATCCAATGGTATCAAATTCCCGTCGGTCTCGGCGTAGCCTTCCTCGGCGTCTTGCAGATCAACAAGGTCATC
TCGAGAGAGCTGGAGACCGATGCGGCACAGCAAAAGCAGCGGCCCAAGGCGCGGCCTGAAGGACCATGGCATGTC
AACCCACGCCGCAGAGCATCATCGGCGGTCTGCATTCTATGGAACAAAGCTGACACTCGCTTCAGGCAAGTTCAG
GTCATGTCGACTCTGCCGCTCAAGGCCATCTCTCGGCTCTGGGGTCGGTTCAACGAGCTGACGATTCCCTACTAC
CTGCGCGTCCCTGGCTTCAAGCTATACTCGTTCATCTTTGGCGTCAACCTCGACGAGGTCTCCGAGCCAGATCTC
CACGTCTATCCCAATCTAGCCGCCTTTTTCTACCGCACTCTCAAACCGGGTGTTCGACCATTGGATCCAGATCCA
AACGCTCTGCTCTCACCGTCGGATGGCAAGGTTCTCCAGTTCGGTCGAATCGAGGGCGGCGACATTGAGCAGGTC
AAAGGGATGACGTACAGCATCGACGCGTTACTTGGCAAGAAAACACCGCCTCCCAGCATACAAAGCTCCAGCGAC
GATTCGCACGGCGATGAAGCCATTGTCAAGCAGGAAGAGGAATTCGCCCAGGTCAACGGCATCTCCTACACGCTC
CCCGACCTCCTGACAGGGCCGAAAAGCACCAAGCCTCGACAGGCGGTGACGGACGAGTCGACCGAGGCATCGCCG
CGGGCCGTATCCGAAGTCCGGGCGGATCTGGCCCTCGGCGAGCGGCCATGGTACGAAGCACTCTCCGCCAACGAG
ACGACAGCGCTCTACTACGCCGTAGTTTACCTGGCGCCCGGCGACTACCATCGCTTCCACTCGCCGACCAATTGG
GTCGTCGAGCGACGGCGACACTTCCCAGGCGAGCTGTTCAGTGTATCGCCCTACCTCCAGCGGACGCTACCTGGC
CTCTTCACGCTCAACGAGCGCGTGGTGCTAATCGGCCGCTGGCGACACGGCTTCTTTAGCTACACCCCCGTCGGT
GCCACCAACGTCGGCTCCATCCGCGTCAACTTCGACCGCGAACTGCGAACAAATAGCCTCACGACGGACACGGCG
GCCGATCAGGCGGCAGCTGAGGCGGCCAAGCGAGGGGAGTCTTACCTCGACTACGTTGAGGCGACGTACGAGGGG
GCCAGCGCCGTGCTGCGAGGCCATGCGCTGCGCAGGGGAGAGGAGATGGGCGGATTCCAGCTGGGCAGCACCGTC
GTCCTCGTCTTCGAGGCTCCGGCCGATAAACGCGCTGGGGCACCGGGCTGGGAGTGGTGTGTGGAAAAGGGGCAG
AAGGTGAAGATGGGACAGCCGCTGGGGCGGGTTTCCGAGGCTGGGACGGGAGAGGCCTCGACGAAGAAGATCAGC
TGA
Gene >Ophun1|5973
ATGAACGCCGTCATCGGAGCCGGCCCCTGTCCGCTCCTTCGACGCCGCGTTCTCGCAGCTGTCCACAGGCCATGT
CCAGGATGCGCATCTCCCAATGTCAGGTCAACAACGGATGCCGGCTTTCGGGGCCTCCGGCAGATGTTTGGCGCG
CGAAGAAGCTATGTCTCCGACGCTGGCAAGCGGCCACGCTTCTCCAAACGTCTCGGCGAGGCCCTTCGCCGCAGT
AGGATCCAATGGTATCAAATTCCCGTCGGTCTCGGCGTAGCCTTCCTCGGCGTCTTGCAGATCAACAAGGTCATC
TCGAGAGAGCTGGAGACCGATGCGGCACAGCAAAAGCAGCGGCCCAAGGCGCGGCCTGAAGGACCATGGCATGTC
AACCCACGCCGCAGAGCATCATCGGCGGTCTGCATTCTATGGAACAAAGCTGACACTCGCTTCAGGCAAGTTCAG
GTCATGTCGACTCTGCCGCTCAAGGCCATCTCTCGGCTCTGGGGTCGGTTCAACGAGCTGACGATTCCCTACTAC
CTGCGCGTCCCTGGCTTCAAGCTATACTCGTTCATCTTTGGCGTCAAGTTTGTGGACAGGCTGCCCAGCTTCCTA
TCCCTTTGCTGACACAAGAACAGCCTCGACGAGGTCTCCGAGCCAGATCTCCACGTCTATCCCAATCTAGCCGCC
TTTTTCTACCGCACTCTCAAACCGGGTGTTCGACCATTGGATCCAGATCCAAACGCTCTGCTCTCACCGTCGGAT
GGCAAGGTTCTCCAGTTCGGTCGAATCGAGGGCGGCGACATTGAGCAGGTCAAAGGGATGACGTACAGCATCGAC
GCGTTACTTGGCAAGAAAACACCGCCTCCCAGCATACAAAGCTCCAGCGACGATTCGCACGGCGATGAAGCCATT
GTCAAGCAGGAAGAGGAATTCGCCCAGGTCAACGGCATCTCCTACACGCTCCCCGACCTCCTGACAGGGCCGAAA
AGCACCAAGCCTCGACAGGCGGTGACGGACGAGTCGACCGAGGCATCGCCGCGGGCCGTATCCGAAGTCCGGGCG
GATCTGGCCCTCGGCGAGCGGCCATGGTACGAAGCACTCTCCGCCAACGAGACGACAGCGCTCTACTACGCCGTA
GTTTACCTGGCGCCCGGCGACTACCATCGCTTCCACTCGCCGACCAATTGGGTCGTCGAGCGACGGCGACACTTC
CCAGGCGAGCTGTTCAGTGTATCGCCCTACCTCCAGCGGACGCTACCTGGCCTCTTCACGCTCAACGAGCGCGTG
GTGCTAATCGGCCGCTGGCGACACGGCTTCTTTAGCTACACCCCCGTCGGTGCCACCAACGTCGGCTCCATCCGC
GTCAACTTCGACCGCGAACTGCGAACAAATAGCCTCACGACGGACACGGCGGCCGATCAGGCGGCAGCTGAGGCG
GCCAAGCGAGGGGAGTCTTACCTCGACTACGTTGAGGCGACGTACGAGGGGGCCAGCGCCGTGCTGCGAGGCCAT
GCGCTGCGCAGGGGAGAGGAGATGGGCGGATTCCAGCTGGGCAGCACCGTCGTCCTCGTCTTCGAGGCTCCGGCC
GATAAACGCGCTGGGGCACCGGGCTGGGAGTGGTGTGTGGAAAAGGGGCAGAAGGTGAAGATGGGACAGCCGCTG
GGGCGGGTTTCCGAGGCTGGGACGGGAGAGGCCTCGACGAAGAAGATCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail