Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5969
Gene name
LocationContig_62:10614..11649
Strand-
Gene length (bp)1035
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 3.9E-04 45 74

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5236
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06113
Ophiocordyceps camponoti-rufipedis Ophun1|5969 (this protein)
Ophiocordyceps kimflemingae Ophio5|2690
Ophiocordyceps subramaniannii Hirsu2|4337
Ophiocordyceps subramaniannii Hirsu2|7029
Ophiocordyceps subramaniannii Hirsu2|8373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5969
MYAMWESHLHACRRAHRDAQWEAFKVPPTLMMMPSQDGQSSALEKLPTEVLLLIMARLGSTDQLFLALTSKKLLA
VSSLNTIIIPSARKHRVNSISCIAMLTLLRTFPPRGPNGRTSTAWAPCCDCYRESLRDVLSCPLDNLADDIARNL
EALPAGVYGWSWGRRCEGGQDG*
Coding >Ophun1|5969
ATGTACGCCATGTGGGAATCTCATCTTCACGCGTGCCGAAGAGCCCACCGCGATGCCCAGTGGGAAGCGTTTAAA
GTCCCCCCCACGCTTATGATGATGCCATCGCAAGACGGGCAATCATCAGCGCTGGAGAAGCTTCCTACGGAAGTG
CTACTCCTCATCATGGCGCGTCTCGGCTCAACAGACCAGCTCTTCCTGGCACTCACGAGCAAGAAACTCCTCGCC
GTCTCCTCCCTGAACACCATCATCATCCCCAGCGCGCGGAAGCATCGCGTCAATAGCATAAGCTGCATCGCGATG
CTCACCCTCCTACGCACCTTTCCACCACGAGGGCCCAACGGACGGACGAGCACGGCGTGGGCGCCCTGCTGCGAC
TGCTACCGAGAGTCCCTGCGTGATGTCCTTTCCTGCCCCCTTGATAACCTGGCTGACGATATCGCCCGCAACCTC
GAGGCCCTTCCCGCCGGCGTCTATGGCTGGAGCTGGGGCCGTCGCTGCGAGGGCGGTCAAGATGGATAG
Transcript >Ophun1|5969
ATGTACGCCATGTGGGAATCTCATCTTCACGCGTGCCGAAGAGCCCACCGCGATGCCCAGTGGGAAGCGTTTAAA
GTCCCCCCCACGCTTATGATGATGCCATCGCAAGACGGGCAATCATCAGCGCTGGAGAAGCTTCCTACGGAAGTG
CTACTCCTCATCATGGCGCGTCTCGGCTCAACAGACCAGCTCTTCCTGGCACTCACGAGCAAGAAACTCCTCGCC
GTCTCCTCCCTGAACACCATCATCATCCCCAGCGCGCGGAAGCATCGCGTCAATAGCATAAGCTGCATCGCGATG
CTCACCCTCCTACGCACCTTTCCACCACGAGGGCCCAACGGACGGACGAGCACGGCGTGGGCGCCCTGCTGCGAC
TGCTACCGAGAGTCCCTGCGTGATGTCCTTTCCTGCCCCCTTGATAACCTGGCTGACGATATCGCCCGCAACCTC
GAGGCCCTTCCCGCCGGCGTCTATGGCTGGAGCTGGGGCCGTCGCTGCGAGGGCGGTCAAGATGGATAG
Gene >Ophun1|5969
ATGTACGCCATGTGGGAATCTCATCTTCACGCGTGCCGAAGAGCCCACCGCGATGCCCAGTGGGAAGCGTTTAAA
GTCCCCCCCACGGTAGGAAAGGAACGCGGAACACGCAAGCCTCGATGATGACACTCGATGTGAGCAGCTTATGAT
GATGCCATCGCAAGACGGGCAATCATCAGCGCTGGAGAAGCTTCCTACGGAAGTGCTACTCCTCATCATGGCGCG
TCTCGGCTCAACAGACCAGCTCTTCCTGGCACTCACGAGCAAGAAACTCCTCGCCGTCTCCTCCCTGAACACCAT
CATCATCCCCAGCGCGCGGAAGCATCGCGTCAATAGCATAAGCTGCATCGCGATGCTCACCCTCCTACGCACCTT
TCCACCACGAGGGCCCAACGGACGGACGAGCACGGCGTGGGCGCCCTGCTGCGACTGCTACCGGTATCGACCCAG
GAAGCTGAAGGGATACTGGGGACGGGTGGGAGAGCGGTATGGAGCGGATGATGAGTCGGATGGGGTGTTTAGGGG
GTATGGTGCTGTTGTCGAGTCGTGGGGGAAGAAGAGCTCTTCTTCGTATCAGTGTCCTGAGTGTTGGTGTTTGGA
TAGTGTGAAGAGGTGGGGGTATTTGAGGCCTGGACTTACGGCTTCGAGGGTGGAAGAGGCTGTCTGATGGTGGGA
AGAGAGGTGGTATCGTCATGGTTCTCATTGAAGAGACCTCACAGGTCTCCTGCTGTAGTATAGAAGAAGCTGTTA
AGAATACCCATGAGTTACATACTGTAGCCTATCCAGTGGGGATATCACCAAGTGTTCAGACAGAAGAAGAGAAAA
CAGCTAAACAATCTGAGTGCCACCCCCCGGCGCAGTGAAGAAATTGGGATTCGGATCCGCCTTATTGAAATCAGA
GAGTCCCTGCGTGATGTCCTTTCCTGCCCCCTTGATAACCTGGCTGACGATATCGCCCGCAACCTCGAGGCCCTT
CCCGCCGGCGTCTATGGCTGGAGCTGGGGCCGTCGCTGCGAGGGCGGTCAAGATGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail