Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5968
Gene name
LocationContig_62:7786..10023
Strand+
Gene length (bp)2237
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 2.3E-27 39 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 1 484 6.0E-177
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 1 447 3.0E-123
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 1 439 3.0E-91
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 1 443 3.0E-57
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 66 439 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 1 484 6.0E-177
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 1 447 3.0E-123
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 1 439 3.0E-91
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 1 443 3.0E-57
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 66 439 1.0E-48
sp|P31440|ADEQ_ECOLI Adenine permease AdeQ OS=Escherichia coli (strain K12) GN=adeQ PE=1 SV=3 33 439 5.0E-48
sp|O34987|PBUG_BACSU Guanine/hypoxanthine permease PbuG OS=Bacillus subtilis (strain 168) GN=pbuG PE=1 SV=1 1 437 1.0E-46
sp|P31466|ADEP_ECOLI Adenine permease AdeP OS=Escherichia coli (strain K12) GN=adeP PE=1 SV=2 33 439 6.0E-41
sp|P0AF52|GHXP_ECOLI Guanine/hypoxanthine permease GhxP OS=Escherichia coli (strain K12) GN=ghxP PE=1 SV=1 49 431 1.0E-32
sp|P0AF53|GHXP_ECO57 Guanine/hypoxanthine permease GhxP OS=Escherichia coli O157:H7 GN=ghxP PE=3 SV=1 49 431 1.0E-32
sp|P44530|Y125_HAEIN Putative permease HI_0125 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0125 PE=3 SV=1 32 431 1.0E-28
sp|Q46817|GHXQ_ECOLI Guanine/hypoxanthine permease GhxQ OS=Escherichia coli (strain K12) GN=ghxQ PE=1 SV=2 288 459 1.0E-15
sp|Q46817|GHXQ_ECOLI Guanine/hypoxanthine permease GhxQ OS=Escherichia coli (strain K12) GN=ghxQ PE=1 SV=2 49 168 8.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 94 116 22
3 136 158 22
4 192 209 17
5 214 233 19
6 276 298 22
7 319 341 22
8 356 378 22
9 399 421 22
10 426 448 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5968
MAYIIAVNASLLSQTGGTCICEQRPHELCDTIPEFRACKEEVRRELITATAAVAGMASIVFGALTNLPVALAPGM
GLNAYFAFQVVGVNGSGNISYRTALTAVFFEGLIFVVLALTGLRQWLVRLIPATIKTATGVGIGLFLTEIGLSYS
VGIGAITGGGKATPLALGGCPLELIDQQSGMCQSGQMTSPKMWTGVICGGIVTSFLMAFRVKYAFVIGIAIVSVL
SWPRHTSISYFPDTDEGNARFAFFQQVVAWHPIRHVANSLDWAFTAGGSHFALALFTFLYVDIIDATATLYSMAR
FCGVADRRDGDFPRSTLAYCTDAVFISVGALLGSSPVTVFIESGAGIAEGGRTGLTAIVAGLCFVASIFFAPIFA
SIPPWATGCTLVLVGCMMMRQISLINWNYFGDVLPSFVVIAFIPFSYSVAYGLIAGLFVYAVLNGLVGLVVLLSG
GRFEPREYELKEYWTWKGGGRPPWFVRAINAHRRRRDAVRELETDDGRGSSLRDSRADSAPKEFPVPAT*
Coding >Ophun1|5968
ATGGCATACATCATCGCCGTCAACGCCTCACTCCTTTCGCAAACGGGCGGGACGTGCATCTGCGAGCAGCGACCG
CACGAGCTCTGCGATACGATCCCGGAGTTTAGGGCCTGCAAGGAAGAGGTTAGGAGGGAGTTGATTACCGCGACG
GCGGCGGTTGCGGGGATGGCGTCGATTGTTTTTGGGGCGTTGACGAATTTGCCTGTTGCGCTTGCCCCCGGAATG
GGCCTCAACGCCTACTTCGCCTTCCAAGTCGTCGGCGTCAACGGCTCAGGCAACATCTCGTACCGCACCGCCCTC
ACCGCCGTCTTCTTCGAAGGCCTCATCTTCGTCGTCCTCGCCCTCACCGGCCTCCGCCAGTGGCTCGTCCGCCTG
ATTCCCGCGACCATCAAGACAGCCACCGGTGTCGGCATCGGCCTCTTCCTCACTGAGATCGGCCTCTCGTACTCG
GTCGGCATCGGTGCCATTACCGGAGGCGGAAAAGCTACTCCTCTCGCTCTCGGCGGCTGTCCGCTCGAGCTCATC
GATCAGCAGTCAGGCATGTGTCAGTCCGGCCAGATGACGAGCCCCAAGATGTGGACGGGTGTCATCTGCGGAGGC
ATCGTCACCTCGTTCCTCATGGCCTTTCGCGTCAAGTACGCGTTTGTCATTGGCATCGCCATCGTTTCCGTCCTC
TCCTGGCCCCGTCATACCTCCATCTCCTACTTCCCCGACACAGACGAAGGCAACGCCCGCTTCGCCTTCTTCCAG
CAAGTCGTCGCCTGGCATCCCATCCGCCACGTCGCCAACAGCCTCGACTGGGCATTCACCGCCGGCGGCTCGCAC
TTTGCCCTCGCTCTCTTCACCTTTCTCTACGTCGACATCATCGACGCCACCGCAACGCTCTACTCCATGGCCCGC
TTCTGCGGCGTCGCTGACCGTCGTGACGGCGACTTTCCGCGCTCCACGCTCGCGTACTGCACCGACGCCGTCTTC
ATCTCCGTCGGCGCTCTGCTGGGCTCCTCGCCCGTTACCGTCTTTATCGAGAGCGGTGCCGGTATTGCTGAGGGG
GGACGGACCGGGCTGACGGCTATTGTCGCTGGCTTGTGCTTTGTTGCCTCCATCTTCTTCGCCCCGATCTTTGCG
TCGATTCCGCCCTGGGCCACGGGCTGTACACTAGTTCTGGTCGGCTGCATGATGATGCGTCAAATCAGCCTCATT
AACTGGAACTACTTTGGAGACGTCCTCCCCTCCTTTGTTGTCATCGCCTTTATCCCTTTTAGCTACAGCGTCGCC
TACGGCCTCATAGCCGGCCTCTTCGTCTACGCCGTGCTCAACGGCCTCGTCGGCCTCGTCGTCCTCCTCAGCGGC
GGCCGTTTCGAGCCCCGGGAGTATGAGTTAAAGGAGTACTGGACCTGGAAAGGCGGAGGCCGTCCGCCCTGGTTC
GTCAGAGCCATCAACGCCCATCGTCGTCGTAGGGACGCCGTTCGCGAGCTTGAGACGGATGACGGCCGCGGGTCC
TCGCTTCGTGACTCTCGCGCTGATTCTGCGCCTAAGGAGTTCCCCGTGCCCGCTACGTGA
Transcript >Ophun1|5968
ATGGCATACATCATCGCCGTCAACGCCTCACTCCTTTCGCAAACGGGCGGGACGTGCATCTGCGAGCAGCGACCG
CACGAGCTCTGCGATACGATCCCGGAGTTTAGGGCCTGCAAGGAAGAGGTTAGGAGGGAGTTGATTACCGCGACG
GCGGCGGTTGCGGGGATGGCGTCGATTGTTTTTGGGGCGTTGACGAATTTGCCTGTTGCGCTTGCCCCCGGAATG
GGCCTCAACGCCTACTTCGCCTTCCAAGTCGTCGGCGTCAACGGCTCAGGCAACATCTCGTACCGCACCGCCCTC
ACCGCCGTCTTCTTCGAAGGCCTCATCTTCGTCGTCCTCGCCCTCACCGGCCTCCGCCAGTGGCTCGTCCGCCTG
ATTCCCGCGACCATCAAGACAGCCACCGGTGTCGGCATCGGCCTCTTCCTCACTGAGATCGGCCTCTCGTACTCG
GTCGGCATCGGTGCCATTACCGGAGGCGGAAAAGCTACTCCTCTCGCTCTCGGCGGCTGTCCGCTCGAGCTCATC
GATCAGCAGTCAGGCATGTGTCAGTCCGGCCAGATGACGAGCCCCAAGATGTGGACGGGTGTCATCTGCGGAGGC
ATCGTCACCTCGTTCCTCATGGCCTTTCGCGTCAAGTACGCGTTTGTCATTGGCATCGCCATCGTTTCCGTCCTC
TCCTGGCCCCGTCATACCTCCATCTCCTACTTCCCCGACACAGACGAAGGCAACGCCCGCTTCGCCTTCTTCCAG
CAAGTCGTCGCCTGGCATCCCATCCGCCACGTCGCCAACAGCCTCGACTGGGCATTCACCGCCGGCGGCTCGCAC
TTTGCCCTCGCTCTCTTCACCTTTCTCTACGTCGACATCATCGACGCCACCGCAACGCTCTACTCCATGGCCCGC
TTCTGCGGCGTCGCTGACCGTCGTGACGGCGACTTTCCGCGCTCCACGCTCGCGTACTGCACCGACGCCGTCTTC
ATCTCCGTCGGCGCTCTGCTGGGCTCCTCGCCCGTTACCGTCTTTATCGAGAGCGGTGCCGGTATTGCTGAGGGG
GGACGGACCGGGCTGACGGCTATTGTCGCTGGCTTGTGCTTTGTTGCCTCCATCTTCTTCGCCCCGATCTTTGCG
TCGATTCCGCCCTGGGCCACGGGCTGTACACTAGTTCTGGTCGGCTGCATGATGATGCGTCAAATCAGCCTCATT
AACTGGAACTACTTTGGAGACGTCCTCCCCTCCTTTGTTGTCATCGCCTTTATCCCTTTTAGCTACAGCGTCGCC
TACGGCCTCATAGCCGGCCTCTTCGTCTACGCCGTGCTCAACGGCCTCGTCGGCCTCGTCGTCCTCCTCAGCGGC
GGCCGTTTCGAGCCCCGGGAGTATGAGTTAAAGGAGTACTGGACCTGGAAAGGCGGAGGCCGTCCGCCCTGGTTC
GTCAGAGCCATCAACGCCCATCGTCGTCGTAGGGACGCCGTTCGCGAGCTTGAGACGGATGACGGCCGCGGGTCC
TCGCTTCGTGACTCTCGCGCTGATTCTGCGCCTAAGGAGTTCCCCGTGCCCGCTACGTGA
Gene >Ophun1|5968
ATGGCATACATCATCGCCGTCAACGTCCGTTCCCTTCCTCCTCGTCCCCTCATACTCCCTTGCTAAGTTGGAGAA
TCTACAGGCCTCACTCCTTTCGCAAACGGGCGGGACGTGCATCTGCGAGCAGCGACCGCACGAGCTCTGCGATAC
GATCCCGGAGTTTAGGGCCTGCAAGGAAGGTTTGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTCGGGTAGGGC
TGTGCTGATGGGTTTGGAAGAGGTTAGGAGGGAGTTGATTACCGCGACGGCGGCGGTTGCGGGGATGGCGTCGAT
TGTTTTTGGGGCGTTGACGAATTTGCCTGTTGCGCTTGCGTACGTATTCTCTCGTCTTCTCTCGACTGGTCTGTC
GTTGCTTCTGTTGTTGTTGTGTTGGTCCATCTCTGTTGTTTATCTTATCCTTATCATTGTTCTTTTCATCTTCCA
TCGTGCTTCTTCTGCCTCATCTGTTATCGTTCTTCCGTCCTCCTTCTATCGCTCTTCTATCTTATCCTTATCTCT
GCTCTTCTTCCAACTACATCTCTCACAAAGCATTCTCTGCCATCTCCATCATCTCTTCCCTTCTTCCTTTCTTCA
TCTCGTCACATCCTTCTATACAACCGTCTCCTCTTCCCTTCCCCCTATCCTCATCTTCACCCTCATCTTCACCCT
CATCTTCACCCTCATCTTCTCCGCCCTCACCACCACAATGACCACGCTGACACCCCCAGCAGCCCCGGAATGGGC
CTCAACGCCTACTTCGCCTTCCAAGTCGTCGGCGTCAACGGCTCAGGCAACATCTCGTACCGCACCGCCCTCACC
GCCGTCTTCTTCGAAGGCCTCATCTTCGTCGTCCTCGCCCTCACCGGCCTCCGCCAGTGGCTCGTCCGCCTGATT
CCCGCGACCATCAAGACAGCCACCGGTGTCGGCATCGGCCTCTTCCTCACTGAGATCGGCCTCTCGTACTCGGTC
GGCATCGGTGCCATTACCGGAGGCGGAAAAGCTACTCCTCTCGCTCTCGGCGGCTGTCCGCTCGAGCTCATCGAT
CAGCAGTCAGGCATGTGTCAGTCCGGCCAGATGACGAGCCCCAAGATGTGGACGGGTGTCATCTGCGGAGGCATC
GTCACCTCGTTCCTCATGGCCTTTCGCGTCAAGTACGCGTTTGTCATTGGCATCGCCATCGTTTCCGTCCTCTCC
TGGCCGTGAGTCACGTCCCATGACCCTCCTCTTGCACCATCTCCCCTGACTACCTCGTCATAGCCGTCATACCTC
CATCTCCTACTTCCCCGACACAGACGAAGGCAACGCCCGCTTCGCCTTCTTCCAGCAAGTCGTCGCCTGGCATCC
CATCCGCCACGTCGCCAACAGCCTCGACTGGGCATTCACCGCCGGCGGCTCGCACTTTGCCCTCGCTCTCTTCAC
CTTTCTCTACGTCGACATCATCGACGCCACCGCAACGCTCTACTCCATGGCCCGCTTCTGCGGCGTCGCTGACCG
TCGTGACGGCGACTTTCCGCGCTCCACGCTCGCGTACTGCACCGACGCCGTCTTCATCTCCGTCGGCGCTCTGCT
GGGCTCCTCGCCCGTTACCGTCTTTATCGAGAGCGGTGCCGGTATTGCTGAGGGGGGACGGACCGGGCTGACGGC
TATTGTCGCTGGCTTGTGCTTTGTTGCCTCCATCTTCTTCGCCCCGATCTTTGCGTCGATTCCGCCCTGGGCCAC
GGGCTGTACACTAGTTCTGGTAAGTCTCTTGTGATCCTCTCATTCTTATGAAGACTTACACGATGCAAGGTCGGC
TGCATGATGATGCGTCAAATCAGCCTCATTAACTGGAACTACTTTGGAGACGTCCTCCCCTCCTTTGTTGTCATC
GCCTTTATCCCTTTTAGCTACAGCGTCGCCTACGGCCTCATAGCGTACGTCCATCTCCATGCCAGTTTTTTCAAT
TGCTAACACCTCACAGCGGCCTCTTCGTCTACGCCGTGCTCAACGGCCTCGTCGGCCTCGTCGTCCTCCTCAGCG
GCGGCCGTTTCGAGCCCCGGGAGTATGAGTTAAAGGAGTACTGGACCTGGAAAGGCGGAGGCCGTCCGCCCTGGT
TCGTCAGAGCCATCAACGCCCATCGTCGTCGTAGGGACGCCGTTCGCGAGCTTGAGACGGATGACGGCCGCGGGT
CCTCGCTTCGTGACTCTCGCGCTGATTCTGCGCCTAAGGAGTTCCCCGTGCCCGCTACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail