Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5966
Gene name
LocationContig_62:331..1802
Strand+
Gene length (bp)1471
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05462 Dicty_CAR Slime mold cyclic AMP receptor 6.7E-12 18 182
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 2.2E-11 13 199
PF00001 7tm_1 7 transmembrane receptor (rhodopsin family) 1.3E-08 28 364
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 1.6E-06 15 187

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O04714|GCR1_ARATH G-protein coupled receptor 1 OS=Arabidopsis thaliana GN=GCR1 PE=1 SV=1 4 198 1.0E-09
sp|P34907|CAR2_DICDI Cyclic AMP receptor 2 OS=Dictyostelium discoideum GN=carB PE=2 SV=2 23 177 2.0E-07
sp|Q60755|CALCR_MOUSE Calcitonin receptor OS=Mus musculus GN=Calcr PE=2 SV=2 73 204 2.0E-06
sp|O08893|CALCR_CAVPO Calcitonin receptor OS=Cavia porcellus GN=CALCR PE=2 SV=1 10 201 6.0E-06

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016021 integral component of membrane Yes
GO:0004930 G protein-coupled receptor activity Yes
GO:0050789 regulation of biological process No
GO:0004888 transmembrane signaling receptor activity No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0038023 signaling receptor activity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0060089 molecular transducer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 47 69 22
3 84 106 22
4 118 140 22
5 164 186 22
6 311 333 22
7 353 375 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5966
MHELTLEQRHAISVIERACSVLSLLGCIFTIVTFCSSRAFHKPINRLVFYASFGNMLTNVGTLMSNAYLSELDSF
GCQFQSFLIQTFMPADAFWTLAMAINVYLTFYHKFDAERLRKMEIVYLLGCYGVPLIPAFTYIFVRNSHGQRIYG
NATLWCWISGEYDVLRIATFYGPVWVTILITFFIYIRAGRTIYEKRKQLYEFQTSDPDPLSINGEVVATIKRTEV
TVTEEDASPCGAIHLGPLSSKQKASDKASSACDGAYSVHISADHCPSPSLDMSSPGKTIQQTSMVQVAPQRPLNP
ARRRHHELNNAAWSYTKCAILFFTAILITWIPSSANRVYSVVHQNEVFPPLEFMSAFVLPLQGLWNAVIYAVTSW
SACQKLFNDLMPLRYRKPVAKITSPDSALAEQGLAARKTGQFRSPPRSSHTFDSESMTELAKSRTASADECHAC*
Coding >Ophun1|5966
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAACGCGCCTGTTCCGTTCTCTCTCTGCTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGTGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCGTTCGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTATCTCAGCGAGCTCGACTCGTTT
GGCTGCCAGTTTCAATCCTTCTTGATCCAAACCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATC
AACGTCTATCTCACCTTTTACCACAAGTTCGACGCCGAGAGGCTTCGCAAGATGGAAATCGTCTACCTTCTCGGC
TGCTATGGCGTCCCTCTTATACCGGCCTTTACCTACATCTTCGTTCGGAACTCGCACGGGCAGCGCATCTACGGC
AATGCCACGCTTTGGTGCTGGATCTCGGGCGAGTACGACGTGTTGCGAATCGCCACCTTTTACGGGCCCGTCTGG
GTCACCATCCTCATCACCTTCTTCATCTATATCCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTGTAC
GAGTTCCAAACCTCAGACCCGGACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTC
ACGGTAACGGAAGAAGACGCCTCCCCTTGCGGAGCCATTCATCTCGGCCCCCTGAGCAGCAAGCAAAAGGCCTCG
GACAAGGCTTCGTCCGCCTGTGACGGCGCCTACTCGGTTCACATCTCGGCTGATCACTGCCCATCCCCGTCTCTG
GACATGTCTTCGCCCGGCAAGACGATACAGCAGACGAGCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAACCCG
GCTCGACGACGCCATCACGAGCTGAACAACGCAGCCTGGTCTTACACCAAGTGTGCCATCCTTTTCTTCACCGCC
ATCCTCATCACCTGGATCCCCTCAAGCGCCAACCGCGTCTACTCGGTCGTCCATCAGAACGAAGTCTTCCCGCCG
CTAGAGTTCATGAGCGCCTTCGTCCTGCCTCTTCAGGGGCTCTGGAACGCCGTCATCTACGCCGTCACCTCTTGG
AGTGCCTGTCAGAAGCTCTTCAACGATCTCATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAACGTCGCCG
GATTCTGCTCTCGCTGAACAAGGCCTCGCTGCCCGCAAGACAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCAT
ACGTTTGACTCGGAGAGCATGACGGAGCTGGCCAAGTCTCGGACCGCCTCGGCAGACGAGTGTCATGCTTGCTGA
Transcript >Ophun1|5966
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAACGCGCCTGTTCCGTTCTCTCTCTGCTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGTGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCGTTCGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTATCTCAGCGAGCTCGACTCGTTT
GGCTGCCAGTTTCAATCCTTCTTGATCCAAACCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATC
AACGTCTATCTCACCTTTTACCACAAGTTCGACGCCGAGAGGCTTCGCAAGATGGAAATCGTCTACCTTCTCGGC
TGCTATGGCGTCCCTCTTATACCGGCCTTTACCTACATCTTCGTTCGGAACTCGCACGGGCAGCGCATCTACGGC
AATGCCACGCTTTGGTGCTGGATCTCGGGCGAGTACGACGTGTTGCGAATCGCCACCTTTTACGGGCCCGTCTGG
GTCACCATCCTCATCACCTTCTTCATCTATATCCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTGTAC
GAGTTCCAAACCTCAGACCCGGACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTC
ACGGTAACGGAAGAAGACGCCTCCCCTTGCGGAGCCATTCATCTCGGCCCCCTGAGCAGCAAGCAAAAGGCCTCG
GACAAGGCTTCGTCCGCCTGTGACGGCGCCTACTCGGTTCACATCTCGGCTGATCACTGCCCATCCCCGTCTCTG
GACATGTCTTCGCCCGGCAAGACGATACAGCAGACGAGCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAACCCG
GCTCGACGACGCCATCACGAGCTGAACAACGCAGCCTGGTCTTACACCAAGTGTGCCATCCTTTTCTTCACCGCC
ATCCTCATCACCTGGATCCCCTCAAGCGCCAACCGCGTCTACTCGGTCGTCCATCAGAACGAAGTCTTCCCGCCG
CTAGAGTTCATGAGCGCCTTCGTCCTGCCTCTTCAGGGGCTCTGGAACGCCGTCATCTACGCCGTCACCTCTTGG
AGTGCCTGTCAGAAGCTCTTCAACGATCTCATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAACGTCGCCG
GATTCTGCTCTCGCTGAACAAGGCCTCGCTGCCCGCAAGACAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCAT
ACGTTTGACTCGGAGAGCATGACGGAGCTGGCCAAGTCTCGGACCGCCTCGGCAGACGAGTGTCATGCTTGCTGA
Gene >Ophun1|5966
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAACGCGCCTGTTCCGTTCTCTCTCTGCTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGTGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCGTTCGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTATCTCAGCGAGCTCGACTCGTTT
GGCTGCCAGTTTCAATCCTTCTTGATCCAAACGTTGGTCGTCTCTCCCCTTTCTTGCTTCGACAGTCGTTGAGCT
GACCCCTTTTCTGCCTCCAGCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATCAACGTCTATCTC
ACCTTTTACCACAAGTTCGACGCCGAGAGGCTTCGCAAGATGGAAATCGTCTACCTTCTCGGCTGCTATGGCGTC
CCTCTTATACCGGCCTTTACCTACATCTTCGTTCGGAACTCGCACGGGCAGCGCATCTACGGCAATGCCACGCTT
TGGTGCTGGATCTCGGGCGAGTACGACGTGTTGCGAATCGCCACCTTTTACGGGCCCGTCTGGTGAGCATACCAT
GTCTTTCTTGCTGTATCGAGCCGTCAAATGGCTAACCTCCATCAGGGTCACCATCCTCATCACCTTCTTCATCTA
TATCCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTGTACGAGTTCCAAACCTCAGACCCGGACCCCCT
ATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTCACGGTAACGGAAGAAGACGCCTCCCCTTG
CGGAGCCATTCATCTCGGCCCCCTGAGCAGCAAGCAAAAGGCCTCGGACAAGGCTTCGTCCGCCTGTGACGGCGC
CTACTCGGTTCACATCTCGGCTGATCACTGCCCATCCCCGTCTCTGGACATGTCTTCGCCCGGCAAGACGATACA
GCAGACGAGCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAACCCGGCTCGACGACGCCATCACGAGCTGAACAA
CGCAGCCTGGTCTTACACCAAGTGTGCCATCCTTTTCTTCACCGCCATCCTCATCACCTGGATCCCCTCAAGCGC
CAACCGCGTCTACTCGGTCGTCCATCAGAACGAAGTCTTCCCGCCGCTAGAGTTCATGAGCGCCTTCGTCCTGCC
TCTTCAGGGGCTCTGGAACGCCGTCATCTACGCCGTCACCTCTTGGAGTGCCTGTCAGAAGCTCTTCAACGATCT
CATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAACGTCGCCGGATTCTGCTCTCGCTGAACAAGGCCTCGC
TGCCCGCAAGACAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCATACGTTTGACTCGGAGAGCATGACGGAGCT
GGCCAAGTCTCGGACCGCCTCGGCAGACGAGTGTCATGCTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail