Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5957
Gene name
LocationContig_618:5258..6783
Strand-
Gene length (bp)1525
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.7E-19 53 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 11 426 4.0E-14
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 4 361 2.0E-13
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 7 419 4.0E-12
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 27 221 2.0E-11
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 60 390 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 11 426 4.0E-14
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 4 361 2.0E-13
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 7 419 4.0E-12
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 27 221 2.0E-11
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 60 390 7.0E-11
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 19 221 1.0E-10
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 41 429 1.0E-10
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 30 426 4.0E-09
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 16 430 4.0E-09
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 27 429 5.0E-09
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 45 419 1.0E-08
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 16 432 2.0E-08
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 100 302 6.0E-08
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 41 410 9.0E-08
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 41 392 1.0E-07
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 16 430 1.0E-07
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 41 358 1.0E-07
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 41 358 2.0E-07
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 23 426 3.0E-07
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 41 230 3.0E-07
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 41 230 5.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 37 209 6.0E-07
sp|O15374|MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens GN=SLC16A4 PE=2 SV=1 28 183 6.0E-07
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 28 432 9.0E-07
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 28 183 9.0E-07
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 38 430 9.0E-07
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 18 353 9.0E-07
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 41 436 1.0E-06
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 41 230 3.0E-06
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 26 376 3.0E-06
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 120 417 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 83 102 19
3 109 131 22
4 136 158 22
5 171 193 22
6 203 225 22
7 245 267 22
8 277 299 22
9 306 328 22
10 332 354 22
11 367 389 22
12 409 426 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5957
MATKDEDVSSSSISPATPTEEALSTEPKDQEAAVPEQQLVDGPRGWIVVAAASCSLFCYMGCIYSWGIVQVQISQ
TTSMTLPSLTFVGSLGTSFMASISPFVGKAIRRFGYRNTALAGAFLLGLGEMLSSWVTYSLPALLITHGCLFGIG
GGMTILPLSTAPLKWFKKHRGLAVGVVFGGSSLGAAIVGVATNFLVRSVGVPWTFRILGLILWSVCLPAAFFIGP
PSSKDLIPRLQWHRWTEPDFLLLFTAGAVSCFPVFVPPYFIPVFARSISHSSSTGIIALTIWNMSSTVGRVVAGF
MADSFLGPINSLCLAIFLCSISALAVWPFASSIGILSLFTVISGTGCGAFFSLFPTVVSAVFGPENTLGVLPMLW
AGWFFGYFFGTPIASRLYALAAVDADTSEYRPAAFYAGATSFIGLVFLIALRYRRSSVLLSRV*
Coding >Ophun1|5957
ATGGCGACAAAGGACGAAGACGTCTCCTCCTCCTCCATCTCGCCCGCTACGCCCACGGAAGAGGCTCTCAGTACC
GAGCCAAAGGATCAGGAAGCGGCGGTGCCTGAACAGCAGCTAGTCGACGGGCCCCGGGGCTGGATCGTCGTTGCT
GCTGCCTCGTGCTCGCTCTTCTGTTACATGGGCTGCATCTACTCATGGGGCATCGTGCAGGTCCAGATATCGCAG
ACGACGTCCATGACGCTGCCTTCGCTGACCTTTGTCGGCTCGCTCGGCACCTCCTTCATGGCTTCTATAAGCCCG
TTTGTGGGAAAGGCCATCCGTCGGTTCGGCTACCGTAACACTGCTCTGGCCGGCGCCTTTCTTCTCGGTCTGGGC
GAGATGCTGTCCAGCTGGGTGACTTACAGTCTTCCGGCTCTGCTCATCACCCACGGCTGCCTCTTTGGCATCGGT
GGAGGAATGACCATATTGCCTCTATCTACCGCGCCACTCAAATGGTTCAAGAAACATCGTGGCCTCGCCGTCGGC
GTCGTCTTCGGCGGCAGCAGTCTGGGCGCTGCCATCGTCGGAGTGGCCACCAACTTCCTCGTCCGCAGCGTCGGC
GTGCCCTGGACCTTTCGAATCTTGGGCCTCATCTTGTGGAGTGTCTGTCTTCCGGCCGCCTTCTTCATCGGGCCC
CCTTCGTCCAAGGACTTGATTCCCCGGCTTCAGTGGCACCGCTGGACCGAGCCGGACTTCCTCCTGCTGTTCACC
GCTGGAGCCGTCTCGTGCTTCCCCGTCTTCGTGCCGCCCTATTTCATCCCCGTCTTTGCCAGGTCCATCAGCCAT
TCAAGCTCGACCGGCATCATCGCCCTCACCATTTGGAATATGTCGTCCACCGTCGGCCGCGTCGTCGCCGGCTTC
ATGGCCGATTCTTTCCTCGGGCCCATCAACAGCCTCTGTCTCGCCATTTTCCTCTGCAGCATCAGTGCCTTGGCC
GTCTGGCCCTTTGCTTCCAGCATCGGCATCCTGTCGCTGTTTACCGTCATCAGCGGTACCGGCTGCGGCGCCTTC
TTTTCGCTCTTCCCGACTGTCGTCTCTGCCGTCTTCGGGCCGGAGAATACGCTGGGGGTGCTCCCTATGCTGTGG
GCTGGCTGGTTCTTTGGATACTTTTTCGGGACGCCCATAGCTTCACGCCTCTACGCCCTGGCAGCGGTCGACGCC
GACACGAGCGAGTACCGTCCGGCTGCCTTTTACGCCGGAGCCACGTCCTTTATCGGTCTCGTCTTTCTCATCGCC
CTTCGCTACCGCCGCAGCAGCGTCTTGCTCTCCCGAGTCTAG
Transcript >Ophun1|5957
ATGGCGACAAAGGACGAAGACGTCTCCTCCTCCTCCATCTCGCCCGCTACGCCCACGGAAGAGGCTCTCAGTACC
GAGCCAAAGGATCAGGAAGCGGCGGTGCCTGAACAGCAGCTAGTCGACGGGCCCCGGGGCTGGATCGTCGTTGCT
GCTGCCTCGTGCTCGCTCTTCTGTTACATGGGCTGCATCTACTCATGGGGCATCGTGCAGGTCCAGATATCGCAG
ACGACGTCCATGACGCTGCCTTCGCTGACCTTTGTCGGCTCGCTCGGCACCTCCTTCATGGCTTCTATAAGCCCG
TTTGTGGGAAAGGCCATCCGTCGGTTCGGCTACCGTAACACTGCTCTGGCCGGCGCCTTTCTTCTCGGTCTGGGC
GAGATGCTGTCCAGCTGGGTGACTTACAGTCTTCCGGCTCTGCTCATCACCCACGGCTGCCTCTTTGGCATCGGT
GGAGGAATGACCATATTGCCTCTATCTACCGCGCCACTCAAATGGTTCAAGAAACATCGTGGCCTCGCCGTCGGC
GTCGTCTTCGGCGGCAGCAGTCTGGGCGCTGCCATCGTCGGAGTGGCCACCAACTTCCTCGTCCGCAGCGTCGGC
GTGCCCTGGACCTTTCGAATCTTGGGCCTCATCTTGTGGAGTGTCTGTCTTCCGGCCGCCTTCTTCATCGGGCCC
CCTTCGTCCAAGGACTTGATTCCCCGGCTTCAGTGGCACCGCTGGACCGAGCCGGACTTCCTCCTGCTGTTCACC
GCTGGAGCCGTCTCGTGCTTCCCCGTCTTCGTGCCGCCCTATTTCATCCCCGTCTTTGCCAGGTCCATCAGCCAT
TCAAGCTCGACCGGCATCATCGCCCTCACCATTTGGAATATGTCGTCCACCGTCGGCCGCGTCGTCGCCGGCTTC
ATGGCCGATTCTTTCCTCGGGCCCATCAACAGCCTCTGTCTCGCCATTTTCCTCTGCAGCATCAGTGCCTTGGCC
GTCTGGCCCTTTGCTTCCAGCATCGGCATCCTGTCGCTGTTTACCGTCATCAGCGGTACCGGCTGCGGCGCCTTC
TTTTCGCTCTTCCCGACTGTCGTCTCTGCCGTCTTCGGGCCGGAGAATACGCTGGGGGTGCTCCCTATGCTGTGG
GCTGGCTGGTTCTTTGGATACTTTTTCGGGACGCCCATAGCTTCACGCCTCTACGCCCTGGCAGCGGTCGACGCC
GACACGAGCGAGTACCGTCCGGCTGCCTTTTACGCCGGAGCCACGTCCTTTATCGGTCTCGTCTTTCTCATCGCC
CTTCGCTACCGCCGCAGCAGCGTCTTGCTCTCCCGAGTCTAG
Gene >Ophun1|5957
ATGGCGACAAAGGACGAAGACGTCTCCTCCTCCTCCATCTCGCCCGCTACGCCCACGGAAGAGGCTCTCAGTACC
GAGCCAAAGGATCAGGAAGCGGCGGTGCCTGAACAGCAGCTAGTCGACGGGCCCCGGGGCTGGATCGTCGTTGCT
GCTGCCTCGTGCTCGCTCTTCTGTTACATGGGCTGCATCTACTCATGGGGCATCGTGCAGGTCCAGATATCGCAG
ACGACGTCCATGACGCTGCCTTCGCTGACCTTTGTCGGCTCGCTCGGCACCTCCTTCATGGCTTCTATAAGCCCG
TTTGTGGGAAAGGCCATCCGTCGGTTCGGCTACCGTAACACTGCTCTGGCCGGCGCCTTTCTTCTCGGTCTGGGC
GAGATGCTGTCCAGCTGGGTGACTTACAGTCTTCCGGCTCTGCTCATCACCCACGGCTGCCTCTTTGGCATCGGT
GGAGGAATGACCATATTGGTATGTATGCTTCAGACGAAAGAAGATACTGTGAGAAAGGGGAGCGTCTTTGTGCTC
ATGTATACATGATTCTGCTACAGCCTCTATCTACCGCGCCACTCAAATGGTTCAAGAAACATCGTGGCCTCGCCG
TCGGCGTCGTCTTCGGCGGCAGCAGTCTGGGCGCTGCCATCGTCGGAGTGGCCACCAACTTCCTCGTCCGCAGCG
TCGGCGTGCCCTGGACCTTTCGAATCTTGGGCCTCATCTTGTGGAGTGTCTGTCTTCCGGCCGCCTTCTTCATCG
GGCCCCCTTCGTCCAAGGACTTGATTCCCCGGCTTCAGTGGTGCGTGACAAGACGAAACTCGGAGAAGGAAGCTC
TACCGCTAATCACAGCTGCTGCTCATGAACAGGCACCGCTGGACCGAGCCGGACTTCCTCCTGCTGTTCACCGCT
GGAGCCGTCTCGTGCTTCCCCGTCTTCGTGCCGCCCTATTTCATCCCCGTCTTTGCCAGGTCCATCAGCCATTCA
AGCTCGACCGGCATCATCGCCCTCACCATTTGGAATATGTCGTCCACCGTCGGCCGCGTCGTCGCCGGCTTCATG
GCCGATTCTTTCCTCGGGCCCATCAACAGCCTCTGTCTCGCCATTTTCCTCTGCAGCATCAGTGCCTTGGCCGTC
TGGCCCTTTGCTTCCAGCATCGGCATCCTGTCGCTGTTTACCGTCATCAGCGGTACCGGCTGCGGCGCCTTCTTT
TCGCTCTTCCCGACTGTCGTCTCTGCCGTCTTCGGGCCGGAGAATACGCTGGGGGTGCTCCCTATGCTGTGGGCT
GGCTGGTTCTTTGGATACTTTTTCGTGAGCCTCATCTAGTCTTTCGTCTGTCGGTGCTTGTCTGGCTTACAAGTC
ATCTTCACAGGGGACGCCCATAGCTTCACGCCTCTACGCCCTGGCAGCGGTCGACGCCGACACGAGCGAGTACCG
TCCGGCTGCCTTTTACGCCGGAGCCACGTCCTTTATCGGTCTCGTCTTTCTCATCGCCCTTCGCTACCGCCGCAG
CAGCGTCTTGCTCTCCCGAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail