Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5954
Gene name
LocationContig_618:298..674
Strand-
Gene length (bp)376
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06842 DUF1242 Protein of unknown function (DUF1242) 6.2E-15 10 44

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5G2S6|KISHA_TAEGU Protein kish-A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1 1 69 9.0E-24
sp|Q9CR64|KISHA_MOUSE Protein kish-A OS=Mus musculus GN=Tmem167a PE=1 SV=1 1 69 9.0E-24
sp|Q5ZII6|KISHA_CHICK Protein kish-A OS=Gallus gallus GN=TMEM167A PE=3 SV=1 1 69 1.0E-23
sp|Q5BJC2|KISHA_DANRE Protein kish-A OS=Danio rerio GN=tmem167a PE=3 SV=1 1 69 2.0E-23
sp|Q5RAL1|KISHA_PONAB Protein kish-A OS=Pongo abelii GN=TMEM167A PE=3 SV=1 1 69 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5G2S6|KISHA_TAEGU Protein kish-A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1 1 69 9.0E-24
sp|Q9CR64|KISHA_MOUSE Protein kish-A OS=Mus musculus GN=Tmem167a PE=1 SV=1 1 69 9.0E-24
sp|Q5ZII6|KISHA_CHICK Protein kish-A OS=Gallus gallus GN=TMEM167A PE=3 SV=1 1 69 1.0E-23
sp|Q5BJC2|KISHA_DANRE Protein kish-A OS=Danio rerio GN=tmem167a PE=3 SV=1 1 69 2.0E-23
sp|Q5RAL1|KISHA_PONAB Protein kish-A OS=Pongo abelii GN=TMEM167A PE=3 SV=1 1 69 3.0E-23
sp|Q8TBQ9|KISHA_HUMAN Protein kish-A OS=Homo sapiens GN=TMEM167A PE=1 SV=1 1 69 3.0E-23
sp|Q148I3|KISHA_BOVIN Protein kish-A OS=Bos taurus GN=TMEM167A PE=3 SV=1 1 69 3.0E-23
sp|G2TRS3|KISH_SCHPO Protein kish OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksh1 PE=2 SV=1 1 71 1.0E-21
sp|Q8TGJ3|KISH_YEAST Protein kish OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSH1 PE=3 SV=1 1 69 7.0E-21
sp|A2VDC5|KISHA_XENLA Protein kish-A OS=Xenopus laevis GN=tmem167a PE=3 SV=1 1 69 3.0E-20
sp|Q28FL7|KISHA_XENTR Protein kish-A OS=Xenopus tropicalis GN=tmem167a PE=3 SV=2 1 69 5.0E-20
sp|Q9VWH8|KISH_DROME Protein kish OS=Drosophila melanogaster GN=ksh PE=3 SV=2 1 69 1.0E-15
sp|Q54HH9|KISH_DICDI Protein kish OS=Dictyostelium discoideum GN=tmem167 PE=3 SV=1 1 69 2.0E-09
sp|Q5RAU6|KISHB_PONAB Protein kish-B OS=Pongo abelii GN=TMEM167B PE=3 SV=1 1 69 8.0E-07
sp|Q9NRX6|KISHB_HUMAN Protein kish-B OS=Homo sapiens GN=TMEM167B PE=3 SV=1 1 69 8.0E-07
sp|Q80X45|KISHB_MOUSE Protein kish-B OS=Mus musculus GN=Tmem167b PE=3 SV=1 1 69 1.0E-06
sp|Q0IIL4|KISHB_BOVIN Protein kish-B OS=Bos taurus GN=TMEM167B PE=3 SV=1 1 69 1.0E-06
sp|Q28GL2|KISHB_XENTR Protein kish-B OS=Xenopus tropicalis GN=tmem167b PE=3 SV=1 1 69 2.0E-06
sp|Q6DE23|KISHB_XENLA Protein kish-B OS=Xenopus laevis GN=tmem167b PE=3 SV=1 1 69 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 49 71 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5954
MSALFNIQSLLLVLLLLTCTSAYIHQIIPRILDSHKDGPLGIIWKFARVGERMSPYISLACVFMAVSMLVGY*
Coding >Ophun1|5954
ATGTCGGCTCTCTTCAACATACAGTCACTGTTGCTCGTGCTCCTCCTCCTCACCTGCACCTCGGCCTATATCCAC
CAGATTATCCCGCGGATACTCGACTCTCACAAGGATGGTCCCCTTGGCATAATATGGAAGTTCGCAAGGGTCGGC
GAGCGCATGAGCCCCTACATCAGCCTGGCCTGCGTCTTTATGGCGGTGTCGATGCTCGTCGGCTACTGA
Transcript >Ophun1|5954
ATGTCGGCTCTCTTCAACATACAGTCACTGTTGCTCGTGCTCCTCCTCCTCACCTGCACCTCGGCCTATATCCAC
CAGATTATCCCGCGGATACTCGACTCTCACAAGGATGGTCCCCTTGGCATAATATGGAAGTTCGCAAGGGTCGGC
GAGCGCATGAGCCCCTACATCAGCCTGGCCTGCGTCTTTATGGCGGTGTCGATGCTCGTCGGCTACTGA
Gene >Ophun1|5954
ATGGTGAGTCTTGGGGCCTGACTTCAAGCGACGTTCTCGCTGACATGCCATCAGTCGGCTCTCTTCAACATACAG
TCACTGTTGCTCGTGCTCCTCCTCCTCACCTGCACCTCGGCCTATATCCACCAGATTATCCCGCGGATACTCGAC
TCTCACAAGGATGGGTGCGATTGTCTTTTTCTCCGATGGTGCAGCAGCTCTCTCTAACGGACTACTAGTCCCCTT
GGCATAATATGGAAGTTCGCAAGGGTCGGCGAGCGCATGAGCCCCTACATCAGCCTGGCCTGCGTCTTTATGGCG
GTGCGCAGAGATCAAACCCCCGGAGGATAGAGCGAAGCTGACGTCTGCCTAGGTGTCGATGCTCGTCGGCTACTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail