Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5951
Gene name
LocationContig_615:8583..10697
Strand+
Gene length (bp)2114
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06772 LtrA Bacterial low temperature requirement A protein (LtrA) 1.0E-18 48 330

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 80 97 17
2 110 129 19
3 139 161 22
4 173 195 22
5 205 227 22
6 240 262 22
7 272 294 22
8 428 450 22
9 486 508 22
10 517 539 22
11 554 576 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5951
MEEGYELSPVSVDKLRLFNSPITETDEKRDENGFEESLPRFQEREEPTLLEVFFDLVFAANYNVFTDNQEVTNTA
RFKAYLGYFFLLWLTWLLVTLFDVRYVTDSIFTRLTRAIQLGVLVGFTIVAPTFNPTNQHQETMRAMSIILVVSR
ACLAVEYGAVLHHVKDYKAARLPIILQICVHFSAAVIYLGLTFGFRGDVKSQDFIVWYFISAAEAMLTVLLSNLY
PVLSFTKTHLIKRLTLLTVIIIGDGIIQVAREVVTIVKNPDAWDGVTIGLVTAAVATIYFVFLVYFDWLRDSFHL
PAIRQQLWMSVHLPFHLSLILFTQGFTQFLIWSKIVDVLNTVSMGFGRKGHEWLTDATTAEVQARLNESTQAFFM
DFPPKIPSTWITINDAISNITLIPDAFWSELSNYYETHNASAFNTTDIKAAQVFSDIMTATMSSMANALFATFGM
DLESDVTNKNPRLYDDIKGGGFQGEVQTETWDRYRLVFACTYLAAASTLLFMIALAILARTTPFKTWPIIRLAII
SGLALGTGMTSILFFNHDRVFKFLLSPWVLPTLAFVWTVTIILTHINAGNVGRRIRRFARRSIGPAFPNITIVAA
DGGWHKMKGEV*
Coding >Ophun1|5951
ATGGAGGAGGGATACGAGCTGAGCCCGGTCTCCGTTGACAAGCTGCGGCTATTCAACAGTCCCATTACCGAGACG
GATGAGAAGCGCGATGAGAATGGATTTGAGGAGTCGTTGCCTCGCTTTCAAGAGCGAGAGGAGCCGACTCTGCTC
GAGGTCTTCTTTGATCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCAACACGGCC
AGGTTCAAGGCCTACCTGGGATACTTCTTTCTCCTCTGGTTGACCTGGCTTCTCGTCACCCTCTTCGACGTCCGA
TACGTTACCGACAGCATCTTCACCCGTCTGACGAGAGCAATCCAGCTCGGCGTCCTGGTTGGCTTCACCATCGTC
GCTCCAACCTTCAACCCAACGAACCAGCATCAAGAAACGATGCGAGCCATGTCCATCATCCTCGTGGTCTCGCGC
GCGTGCTTGGCTGTCGAGTACGGAGCTGTCCTTCACCACGTTAAAGACTACAAGGCAGCTCGCCTCCCCATCATC
CTGCAGATATGCGTCCACTTTTCGGCGGCCGTCATCTATCTCGGCCTCACGTTCGGATTCCGCGGCGACGTCAAG
AGCCAGGACTTTATCGTGTGGTACTTTATTTCTGCGGCGGAGGCTATGCTCACTGTCCTGCTGTCGAACCTGTAT
CCCGTTCTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTGACCGTCATCATCATCGGTGACGGC
ATCATACAGGTGGCAAGGGAGGTCGTCACCATTGTCAAGAACCCGGATGCCTGGGACGGGGTAACGATCGGGCTC
GTTACGGCTGCTGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTCGACTGGCTGCGAGACTCGTTCCATCTG
CCAGCCATCCGTCAGCAGCTGTGGATGAGCGTCCATCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGC
TTCACGCAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACAGTGAGCATGGGCTTCGGCCGCAAGGGA
CATGAGTGGCTCACAGACGCCACCACCGCAGAGGTTCAAGCCAGACTCAACGAGAGCACGCAGGCCTTCTTCATG
GACTTCCCGCCCAAGATTCCAAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCTGAC
GCCTTCTGGTCCGAGCTCTCCAACTACTATGAGACGCACAATGCCTCCGCATTCAACACCACGGACATCAAGGCC
GCTCAGGTCTTTTCCGATATTATGACGGCCACCATGTCGTCCATGGCTAACGCCCTGTTTGCTACCTTTGGCATG
GATCTTGAAAGCGACGTCACCAACAAGAACCCCCGACTCTACGATGATATCAAGGGCGGTGGCTTCCAGGGAGAG
GTTCAGACTGAGACGTGGGATCGATACCGGCTTGTGTTTGCTTGCACCTATCTCGCCGCTGCCTCTACCCTCTTA
TTCATGATCGCCCTCGCCATCCTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTGGCCATCATC
TCTGGTCTCGCTCTCGGCACCGGCATGACTTCCATTCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTA
TCGCCATGGGTCTTGCCCACCCTTGCCTTTGTATGGACCGTCACCATCATCCTCACTCACATCAATGCTGGCAAC
GTCGGACGTCGCATACGCCGCTTTGCTCGTCGCAGCATTGGTCCGGCTTTTCCAAACATTACTATTGTCGCAGCT
GACGGAGGATGGCACAAGATGAAAGGTGAAGTGTGA
Transcript >Ophun1|5951
ATGGAGGAGGGATACGAGCTGAGCCCGGTCTCCGTTGACAAGCTGCGGCTATTCAACAGTCCCATTACCGAGACG
GATGAGAAGCGCGATGAGAATGGATTTGAGGAGTCGTTGCCTCGCTTTCAAGAGCGAGAGGAGCCGACTCTGCTC
GAGGTCTTCTTTGATCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCAACACGGCC
AGGTTCAAGGCCTACCTGGGATACTTCTTTCTCCTCTGGTTGACCTGGCTTCTCGTCACCCTCTTCGACGTCCGA
TACGTTACCGACAGCATCTTCACCCGTCTGACGAGAGCAATCCAGCTCGGCGTCCTGGTTGGCTTCACCATCGTC
GCTCCAACCTTCAACCCAACGAACCAGCATCAAGAAACGATGCGAGCCATGTCCATCATCCTCGTGGTCTCGCGC
GCGTGCTTGGCTGTCGAGTACGGAGCTGTCCTTCACCACGTTAAAGACTACAAGGCAGCTCGCCTCCCCATCATC
CTGCAGATATGCGTCCACTTTTCGGCGGCCGTCATCTATCTCGGCCTCACGTTCGGATTCCGCGGCGACGTCAAG
AGCCAGGACTTTATCGTGTGGTACTTTATTTCTGCGGCGGAGGCTATGCTCACTGTCCTGCTGTCGAACCTGTAT
CCCGTTCTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTGACCGTCATCATCATCGGTGACGGC
ATCATACAGGTGGCAAGGGAGGTCGTCACCATTGTCAAGAACCCGGATGCCTGGGACGGGGTAACGATCGGGCTC
GTTACGGCTGCTGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTCGACTGGCTGCGAGACTCGTTCCATCTG
CCAGCCATCCGTCAGCAGCTGTGGATGAGCGTCCATCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGC
TTCACGCAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACAGTGAGCATGGGCTTCGGCCGCAAGGGA
CATGAGTGGCTCACAGACGCCACCACCGCAGAGGTTCAAGCCAGACTCAACGAGAGCACGCAGGCCTTCTTCATG
GACTTCCCGCCCAAGATTCCAAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCTGAC
GCCTTCTGGTCCGAGCTCTCCAACTACTATGAGACGCACAATGCCTCCGCATTCAACACCACGGACATCAAGGCC
GCTCAGGTCTTTTCCGATATTATGACGGCCACCATGTCGTCCATGGCTAACGCCCTGTTTGCTACCTTTGGCATG
GATCTTGAAAGCGACGTCACCAACAAGAACCCCCGACTCTACGATGATATCAAGGGCGGTGGCTTCCAGGGAGAG
GTTCAGACTGAGACGTGGGATCGATACCGGCTTGTGTTTGCTTGCACCTATCTCGCCGCTGCCTCTACCCTCTTA
TTCATGATCGCCCTCGCCATCCTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTGGCCATCATC
TCTGGTCTCGCTCTCGGCACCGGCATGACTTCCATTCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTA
TCGCCATGGGTCTTGCCCACCCTTGCCTTTGTATGGACCGTCACCATCATCCTCACTCACATCAATGCTGGCAAC
GTCGGACGTCGCATACGCCGCTTTGCTCGTCGCAGCATTGGTCCGGCTTTTCCAAACATTACTATTGTCGCAGCT
GACGGAGGATGGCACAAGATGAAAGGTGAAGTGTGA
Gene >Ophun1|5951
ATGGAGGAGGGATACGAGCTGAGCCCGGTCTCCGTTGACAAGCTGCGGCTATTCAACAGTCCCATTACCGAGACG
GATGAGAAGCGCGATGAGAATGGATTTGAGGAGTCGTTGCCTCGCTTTCAAGAGGTTTGTGATTGTGGGAAGGGG
GCTGGATGCGAGTGATGCTGATGGTGTATAGCGAGAGGAGCCGACTCTGCTCGAGGTCTTCTTTGATCTCGTCTT
TGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCAACACGGCCAGGTTCAAGGCCTACCTGGGATA
CTTCTTGTATGTGGACATCGATGGCTGGAAGAGGCCACAATTATACTATATGCTGATGCTGTTTTGACAGTCTCC
TCTGGTTGACCTGGCTTCTCGTCACCCTCTTCGACGTCCGATACGTTACCGACAGCATCTTCAGTAGGCGTCTTC
CACCTCAACTGAACTCACAGATGCTGACATACTCTCAATAGCCCGTCTGACGAGAGCAATCCAGCTCGGCGTCCT
GGTTGGCTTCACCATCGTCGCTCCAACCTTCAACCCAACGAACCAGCATCAAGAAACGATGCGAGCCATGTGTAA
GCCCGCTTCAGCTAGTCAGCCAAGACGATATACTAACTCCAGCAGCCATCATCCTCGTGGTCTCGCGCGCGTGCT
TGGCTGTCGAGTACGGAGCTGTCCTTCACCACGTTAAAGACTACAAGGCAGCTCGCCTCCCCATCATCCTGCAGA
TATGCGTCCACTTTTCGGCGGCCGTCATCTATCTCGGCCTCACGTTCGGATTCCGCGGCGACGTCAAGAGCCAGG
ACTTTATCGTGTGGTACTTTATTTCTGCGGCGGAGGCTATGCTCACTGTCCTGCTGTCGAACCTGTATCCCGTTC
TCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTGACCGTCATCATCATCGGTGACGGCATCATAC
AGGTGGCAAGGGAGGTCGTCACCATTGTCAAGAACCCGGATGCCTGGGACGGGGTAACGATCGGGCTCGTTACGG
CTGCTGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTCGACTGGCTGCGAGACTCGTTCCATCTGCCAGCCA
TCCGTCAGCAGCTGTGGATGAGCGTCCATCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGCTTCACGC
AGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACAGTGAGCATGGGCTTCGGCCGCAAGGGACATGAGT
GGCTCACAGACGCCACCACCGCAGAGGTTCAAGCCAGACTCAACGAGAGCACGCAGGCCTTCTTCATGGACTTCC
CGCCCAAGATTCCAAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCTGACGCCTTCT
GGTCCGAGCTCTCCAACTACTATGAGACGCACAATGCCTCCGCATTCAACACCACGGACATCAAGGCCGCTCAGG
TCTTTTCCGATATTATGACGGCCACCATGTCGTCCATGGCTAACGCCCTGTTTGCTACCTTTGGCATGGATCTTG
AAAGCGACGTCACCAACAAGAACCCCCGACTCTACGATGATATCAAGGGCGGTGGCTTCCAGGGAGAGGTTCAGA
CTGAGACGTGGGATCGATACCGGCTTGTGGTGAGTTGCATACGCTCTATCCGTACCAGAGGTTGCACATGTTTGC
TGACTATCATCCAGTTTGCTTGCACCTATCTCGCCGCTGCCTCTACCCTCTTATTCATGATCGCCCTCGCCATCC
TGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTGGCCATCATCTCTGGTCTCGCTCTCGGCACCG
GCATGACTTCCATTCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTATCGCCATGGGTCTTGCCCACCC
TTGCCTTTGTATGGACCGTCACCATCATCCTCACTCACATCAATGCTGGCAACGTCGGACGTCGCATACGCCGCT
TTGCTCGTCGCAGCATTGGTCCGGCTTTTCCAAACATTACTATTGTCGCAGCTGACGGAGGATGGCACAAGATGA
AAGGTGAAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail