Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5948
Gene name
LocationContig_615:1292..3297
Strand-
Gene length (bp)2005
Transcript length (bp)1776
Coding sequence length (bp)1776
Protein length (aa) 592

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.0E-21 118 264
PF08031 BBE Berberine and berberine like 3.3E-08 535 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 577 4.0E-71
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 26 589 2.0E-57
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 91 327 8.0E-14
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 118 330 1.0E-10
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 121 303 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 24 577 4.0E-71
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 26 589 2.0E-57
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 91 327 8.0E-14
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 118 330 1.0E-10
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 121 303 2.0E-10
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 121 303 4.0E-10
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 117 306 9.0E-10
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 117 299 6.0E-09
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 118 332 6.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 118 297 1.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 121 303 1.0E-08
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 147 306 2.0E-08
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 118 301 2.0E-08
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 147 306 2.0E-08
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 137 298 2.0E-08
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 117 306 3.0E-08
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 118 309 5.0E-08
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 121 303 7.0E-08
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 194 296 7.0E-08
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 197 302 1.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 194 325 1.0E-07
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 117 300 2.0E-07
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 194 296 5.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 118 387 8.0E-07
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 196 297 9.0E-07
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 196 297 2.0E-06
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 121 568 3.0E-06
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 143 289 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999753

Transmembrane Domains

Domain # Start End Length
1 5 22 17

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 2.3E-47 117 303

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097
Ophiocordyceps camponoti-floridani Ophcf2|00778
Ophiocordyceps camponoti-floridani Ophcf2|03867
Ophiocordyceps camponoti-rufipedis Ophun1|5948 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804
Ophiocordyceps subramaniannii Hirsu2|9391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5948
MAKHTLVFVLFYSLIGLVVGHYSRHCKAFPGDHDWPSQQAWHGLNVTVQGRLLAPSPPGAVCHRDRPTFNPEQCP
RVQKAWTTFEFHAKDPLSVVWNQWTGFDCLPDPSTTCTGRGYPAYVVDASGTEDVKMAVDFARKHNVRLVVKNTG
YDFLGRSTAPAALSIRTINMKTIRLHAKGCFKLSSGRTFSGTAITVGAGTLTVDIYRALDEHGQTFIGAMGPTVG
ITGFLSGGGHSNLSGRYGLGADAVLEMEVVTPGGEVLTVNEDRHSDLFWALRGGGGSTFGVVTKITMSTFPTPQV
LGVQWIAGIDASDAQATDLAPALMSKLPEAIDAGLLGWNAVMNKMHNPIPAPGALQGNISGLWGVSAILDTTSPS
EANRILKPLSDILQRPEWKGKARLWLKTKSFPSYLAYVNGVYAPRPGGYGWWEVSRMLDRKALSGDTEALANALR
AVSSDRGNLFAMTLAGRGVQLVRPAGGDNSVNPAWRSAYALGMTSLTFKDEKASKEIRDFLNTAWQPMRDLTPET
GSYIDEASITGMPYEKDWQHTFWGSNYERLLDIKRRVDPDDVLWCSPCVGNERWRQGRDGRLCRIR*
Coding >Ophun1|5948
ATGGCGAAGCACACGCTCGTTTTCGTCCTTTTCTACAGCCTGATAGGCCTCGTCGTCGGCCACTACTCACGACAC
TGCAAGGCCTTCCCAGGGGATCACGACTGGCCATCACAGCAAGCATGGCACGGCCTCAACGTCACGGTCCAAGGC
CGTCTGCTGGCTCCGTCTCCCCCGGGAGCCGTCTGCCACCGCGACAGACCGACCTTCAACCCCGAGCAGTGCCCG
CGGGTGCAGAAGGCGTGGACGACGTTTGAGTTTCATGCAAAGGACCCCTTGTCGGTGGTGTGGAATCAGTGGACG
GGCTTTGACTGTCTGCCTGATCCGAGCACCACGTGCACTGGGAGGGGATATCCTGCGTATGTGGTGGATGCGTCT
GGGACCGAGGACGTCAAGATGGCCGTCGACTTTGCTCGCAAGCACAACGTCAGACTCGTCGTCAAAAACACAGGC
TACGATTTCCTCGGCCGCTCCACCGCCCCAGCCGCCCTCTCCATCCGAACCATCAACATGAAGACGATCCGCCTC
CACGCAAAGGGCTGCTTCAAGCTCAGCAGCGGCCGCACCTTCAGCGGAACAGCCATCACCGTCGGCGCCGGAACC
CTCACCGTCGACATCTACCGCGCCCTCGACGAGCACGGCCAGACCTTTATCGGCGCCATGGGTCCTACCGTCGGT
ATCACGGGCTTTCTCTCTGGCGGAGGACACTCGAATCTCTCGGGGAGGTATGGGCTTGGGGCTGATGCTGTTCTT
GAGATGGAGGTTGTTACCCCTGGAGGTGAGGTTTTGACGGTCAACGAGGATCGGCATAGTGATTTGTTCTGGGCG
TTGCGCGGTGGCGGCGGCTCAACCTTTGGCGTCGTCACAAAGATCACCATGAGCACCTTTCCCACCCCTCAAGTC
CTCGGCGTCCAGTGGATAGCCGGTATCGACGCTTCAGACGCCCAAGCCACAGACCTCGCCCCAGCCCTCATGTCC
AAGCTCCCCGAAGCCATCGACGCCGGCCTCCTAGGCTGGAACGCGGTAATGAACAAGATGCACAACCCAATCCCC
GCCCCAGGCGCTCTACAAGGAAACATCAGCGGCCTCTGGGGCGTCAGCGCCATCCTCGACACCACCTCCCCCTCC
GAAGCCAACCGCATCCTCAAACCCCTATCCGACATACTCCAACGCCCCGAATGGAAAGGAAAAGCCCGCCTCTGG
CTGAAAACAAAGTCGTTCCCCTCCTACCTCGCCTACGTCAATGGCGTCTACGCCCCGAGGCCCGGCGGCTACGGC
TGGTGGGAGGTTTCGCGCATGCTGGATCGCAAGGCGCTCAGTGGCGATACCGAGGCTCTGGCCAATGCTTTGCGG
GCTGTCAGCAGCGACAGGGGGAATCTGTTTGCCATGACGCTGGCGGGCAGGGGCGTGCAGCTTGTCAGGCCTGCT
GGGGGCGACAACTCGGTCAACCCGGCGTGGCGCAGCGCCTACGCTCTGGGCATGACCTCCCTGACCTTTAAAGAC
GAAAAGGCCTCCAAGGAGATACGCGATTTCCTCAACACAGCCTGGCAGCCAATGCGGGATCTGACCCCCGAGACA
GGCTCCTACATCGACGAGGCGAGCATCACCGGCATGCCGTACGAAAAAGACTGGCAGCACACCTTCTGGGGCTCC
AACTACGAACGCCTCCTCGACATCAAGCGCCGGGTCGACCCGGACGACGTGCTCTGGTGCTCACCCTGCGTCGGA
AACGAGCGCTGGCGGCAGGGACGGGATGGGAGGCTGTGCAGAATCCGCTAG
Transcript >Ophun1|5948
ATGGCGAAGCACACGCTCGTTTTCGTCCTTTTCTACAGCCTGATAGGCCTCGTCGTCGGCCACTACTCACGACAC
TGCAAGGCCTTCCCAGGGGATCACGACTGGCCATCACAGCAAGCATGGCACGGCCTCAACGTCACGGTCCAAGGC
CGTCTGCTGGCTCCGTCTCCCCCGGGAGCCGTCTGCCACCGCGACAGACCGACCTTCAACCCCGAGCAGTGCCCG
CGGGTGCAGAAGGCGTGGACGACGTTTGAGTTTCATGCAAAGGACCCCTTGTCGGTGGTGTGGAATCAGTGGACG
GGCTTTGACTGTCTGCCTGATCCGAGCACCACGTGCACTGGGAGGGGATATCCTGCGTATGTGGTGGATGCGTCT
GGGACCGAGGACGTCAAGATGGCCGTCGACTTTGCTCGCAAGCACAACGTCAGACTCGTCGTCAAAAACACAGGC
TACGATTTCCTCGGCCGCTCCACCGCCCCAGCCGCCCTCTCCATCCGAACCATCAACATGAAGACGATCCGCCTC
CACGCAAAGGGCTGCTTCAAGCTCAGCAGCGGCCGCACCTTCAGCGGAACAGCCATCACCGTCGGCGCCGGAACC
CTCACCGTCGACATCTACCGCGCCCTCGACGAGCACGGCCAGACCTTTATCGGCGCCATGGGTCCTACCGTCGGT
ATCACGGGCTTTCTCTCTGGCGGAGGACACTCGAATCTCTCGGGGAGGTATGGGCTTGGGGCTGATGCTGTTCTT
GAGATGGAGGTTGTTACCCCTGGAGGTGAGGTTTTGACGGTCAACGAGGATCGGCATAGTGATTTGTTCTGGGCG
TTGCGCGGTGGCGGCGGCTCAACCTTTGGCGTCGTCACAAAGATCACCATGAGCACCTTTCCCACCCCTCAAGTC
CTCGGCGTCCAGTGGATAGCCGGTATCGACGCTTCAGACGCCCAAGCCACAGACCTCGCCCCAGCCCTCATGTCC
AAGCTCCCCGAAGCCATCGACGCCGGCCTCCTAGGCTGGAACGCGGTAATGAACAAGATGCACAACCCAATCCCC
GCCCCAGGCGCTCTACAAGGAAACATCAGCGGCCTCTGGGGCGTCAGCGCCATCCTCGACACCACCTCCCCCTCC
GAAGCCAACCGCATCCTCAAACCCCTATCCGACATACTCCAACGCCCCGAATGGAAAGGAAAAGCCCGCCTCTGG
CTGAAAACAAAGTCGTTCCCCTCCTACCTCGCCTACGTCAATGGCGTCTACGCCCCGAGGCCCGGCGGCTACGGC
TGGTGGGAGGTTTCGCGCATGCTGGATCGCAAGGCGCTCAGTGGCGATACCGAGGCTCTGGCCAATGCTTTGCGG
GCTGTCAGCAGCGACAGGGGGAATCTGTTTGCCATGACGCTGGCGGGCAGGGGCGTGCAGCTTGTCAGGCCTGCT
GGGGGCGACAACTCGGTCAACCCGGCGTGGCGCAGCGCCTACGCTCTGGGCATGACCTCCCTGACCTTTAAAGAC
GAAAAGGCCTCCAAGGAGATACGCGATTTCCTCAACACAGCCTGGCAGCCAATGCGGGATCTGACCCCCGAGACA
GGCTCCTACATCGACGAGGCGAGCATCACCGGCATGCCGTACGAAAAAGACTGGCAGCACACCTTCTGGGGCTCC
AACTACGAACGCCTCCTCGACATCAAGCGCCGGGTCGACCCGGACGACGTGCTCTGGTGCTCACCCTGCGTCGGA
AACGAGCGCTGGCGGCAGGGACGGGATGGGAGGCTGTGCAGAATCCGCTAG
Gene >Ophun1|5948
ATGGCGAAGCACACGCTCGTTTTCGTCCTTTTCTACAGCCTGATAGGCCTCGTCGTCGGCCACTACTCACGACAC
TGCAAGGCCTTCCCAGGGGATCACGACTGGCCATCACAGCAAGCATGGCACGGCCTCAACGTCACGGTCCAAGGC
CGTCTGCTGGCTCCGTCTCCCCCGGGAGCCGTCTGCCACCGCGACAGACCGACCTTCAACCCCGAGCAGTGCCCG
CGGGTGCAGAAGGCGTGGACGACGTTTGAGTTTCATGCAAAGGACCCCTTGTCGGTGGTGTGGAATCAGTGGACG
GGCTTTGACTGTCTGCCTGATCCGAGCACCACGTGCACTGGGAGGGGATATCCTGCGTATGTGGTGGATGCGTCT
GGGACCGAGGACGTCAAGATGGCCGTCGACTTTGGTATGTGTCCATCTCTTTACATACTTCCATCTCGTCTGAAG
AGCATCATGCTGACTCCATGTCTGTAAAGCTCGCAAGCACAACGTCAGACTCGTCGTCAAAAACACAGGCTACGA
TTTCCTCGGCCGCTCCACCGCCCCAGCCGCCCTCTCCATCCGAACCATCAACATGAAGACGATCCGCCTCCACGC
AAAGGGCTGCTTCAAGCTCAGCAGCGGCCGCACCTTCAGCGGAACAGCCATCACCGTCGGCGCCGGAACCCTCAC
CGTCGACATCTACCGCGCCCTCGACGAGCACGGCCAGACCTTTATCGGCGCCATGGGTCCTACCGTCGGTATCAC
GGGCTTTCTCTCTGGCGGAGGACACTCGAATCTCTCGGGGAGGTATGGGCTTGGGGCTGATGCTGTTCTTGAGAT
GGAGGTTGTTACCCCTGGAGGTGAGGTTTTGACGGTCAACGAGGATCGGCATAGTGATTTGTTCTGGGCGTTGCG
CGGTGTAAGTCCATCCCCAGCCACGCAACTAAATACTAACAACGAGACTGACCCTTATCCTTGAATACAGGGCGG
CGGCTCAACCTTTGGCGTCGTCACAAAGATCACCATGAGCACCTTTCCCACCCCTCAAGTCCTCGGCGTCCAGTG
GATAGCCGGTATCGACGCTTCAGACGCCCAAGCCACAGACCTCGCCCCAGCCCTCATGTCCAAGCTCCCCGAAGC
CATCGACGCCGGCCTCCTAGGCTGGAACGCGGTAATGAACAAGATGCACAACCCAATCCCCGCCCCAGGCGCTCT
ACAAGGAAACATCAGCGGCCTCTGGGGCGTCAGCGCCATCCTCGACACCACCTCCCCCTCCGAAGCCAACCGCAT
CCTCAAACCCCTATCCGACATACTCCAACGCCCCGAATGGAAAGGAAAAGCCCGCCTCTGGCTGAAAACAAAGTC
GTTCCCCTCCTACCTCGCCTACGTCAATGGCGTCTACGCCCCGAGGCCCGGCGGCTACGGCTGGTGGGAGGTTTC
GCGCATGCTGGATCGCAAGGCGCTCAGTGGCGATACCGAGGCTCTGGCCAATGCTTTGCGGGCTGTCAGCAGCGA
CAGGGGGAATCTGTTTGCCATGACGCTGGCGGGCAGGGGCGTGCAGCTTGTCAGGCCTGCTGGGGGCGACAACTC
GGTCAACCCGGCGTGGCGCAGCGCCTACGCTCTGGGCAGTACGTGAATGATGGCGGTGATGGTGAATGACTCCTT
ACTGACGCGTCTCAGTGACCTCCCTGACCTTTAAAGACGAAAAGGCCTCCAAGGAGATACGCGATTTCCTCAACA
CAGCCTGGCAGCCAATGCGGGATCTGACCCCCGAGACAGGCTCCTACATCGACGAGGCGAGCATCACCGTCCCTA
CACCCTCTTCCTCTCCCCTCTAACGCAACATCAGGGCATGCCGTACGAAAAAGACTGGCAGCACACCTTCTGGGG
CTCCAACTACGAACGCCTCCTCGACATCAAGCGCCGGGTCGACCCGGACGACGTGCTCTGGTGCTCACCCTGCGT
CGGAAACGAGCGCTGGCGGCAGGGACGGGATGGGAGGCTGTGCAGAATCCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail