Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5940
Gene name
LocationContig_613:8241..9165
Strand+
Gene length (bp)924
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A) 1.9E-43 60 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CFH4|RPIA_YARLI Ribose-5-phosphate isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RKI1 PE=3 SV=1 6 277 7.0E-54
sp|Q4P6V4|RPIA_USTMA Ribose-5-phosphate isomerase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RKI1 PE=3 SV=1 10 284 8.0E-53
sp|A3LP13|RPIA_PICST Ribose-5-phosphate isomerase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RKI1 PE=3 SV=1 4 279 2.0E-52
sp|Q5AJ92|RPIA_CANAL Ribose-5-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RKI1 PE=3 SV=1 4 279 5.0E-51
sp|Q9UTL3|RPIA_SCHPO Ribose-5-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rki1 PE=3 SV=1 10 284 2.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CFH4|RPIA_YARLI Ribose-5-phosphate isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RKI1 PE=3 SV=1 6 277 7.0E-54
sp|Q4P6V4|RPIA_USTMA Ribose-5-phosphate isomerase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RKI1 PE=3 SV=1 10 284 8.0E-53
sp|A3LP13|RPIA_PICST Ribose-5-phosphate isomerase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RKI1 PE=3 SV=1 4 279 2.0E-52
sp|Q5AJ92|RPIA_CANAL Ribose-5-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RKI1 PE=3 SV=1 4 279 5.0E-51
sp|Q9UTL3|RPIA_SCHPO Ribose-5-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rki1 PE=3 SV=1 10 284 2.0E-50
sp|Q75CJ6|RPIA_ASHGO Ribose-5-phosphate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RKI1 PE=3 SV=1 8 279 1.0E-49
sp|Q6BYI4|RPIA_DEBHA Ribose-5-phosphate isomerase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RKI1 PE=3 SV=2 2 278 3.0E-49
sp|A5DXV6|RPIA_LODEL Ribose-5-phosphate isomerase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RKI1 PE=3 SV=1 2 248 7.0E-49
sp|Q12189|RPIA_YEAST Ribose-5-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKI1 PE=1 SV=1 10 279 3.0E-46
sp|A6ZNU5|RPIA_YEAS7 Ribose-5-phosphate isomerase OS=Saccharomyces cerevisiae (strain YJM789) GN=RKI1 PE=3 SV=1 10 279 3.0E-46
sp|A7TLF7|RPIA_VANPO Ribose-5-phosphate isomerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RKI1 PE=3 SV=1 7 279 1.0E-45
sp|Q6CTD5|RPIA_KLULA Ribose-5-phosphate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RKI1 PE=3 SV=1 7 281 2.0E-45
sp|P0CR18|RPIA_CRYNJ Ribose-5-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RKI1 PE=3 SV=1 10 285 3.0E-45
sp|P0CR19|RPIA_CRYNB Ribose-5-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RKI1 PE=3 SV=1 10 285 3.0E-45
sp|Q551C2|RPIA_DICDI Ribose-5-phosphate isomerase OS=Dictyostelium discoideum GN=rpiA PE=3 SV=1 10 280 4.0E-45
sp|A5DFH6|RPIA_PICGU Ribose-5-phosphate isomerase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RKI1 PE=3 SV=2 1 280 9.0E-45
sp|Q6FLF8|RPIA_CANGA Ribose-5-phosphate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RKI1 PE=3 SV=1 10 279 1.0E-44
sp|A2TLM1|RPIA_PIG Ribose-5-phosphate isomerase OS=Sus scrofa GN=RPIA PE=2 SV=1 11 281 2.0E-40
sp|P49247|RPIA_HUMAN Ribose-5-phosphate isomerase OS=Homo sapiens GN=RPIA PE=1 SV=3 11 281 5.0E-40
sp|Q3T186|RPIA_BOVIN Ribose-5-phosphate isomerase (Fragment) OS=Bos taurus GN=RPIA PE=2 SV=2 11 281 9.0E-40
sp|P47968|RPIA_MOUSE Ribose-5-phosphate isomerase OS=Mus musculus GN=Rpia PE=1 SV=2 11 280 1.0E-39
sp|P41994|RPIA_CAEEL Probable-ribose 5-phosphate isomerase OS=Caenorhabditis elegans GN=rpia-1 PE=3 SV=1 10 247 1.0E-34
sp|Q8Q0R3|RPIA_METMA Ribose-5-phosphate isomerase A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpiA PE=3 SV=1 5 279 6.0E-31
sp|Q8TQ69|RPIA_METAC Ribose-5-phosphate isomerase A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpiA PE=3 SV=1 5 245 6.0E-30
sp|Q9V0L6|RPIA_PYRAB Ribose-5-phosphate isomerase A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpiA PE=3 SV=1 10 245 5.0E-29
sp|O50083|RPIA_PYRHO Ribose-5-phosphate isomerase A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpiA PE=1 SV=1 10 245 1.0E-28
sp|P72012|RPIA_METTH Ribose-5-phosphate isomerase A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpiA PE=3 SV=1 14 248 9.0E-27
sp|B7K6D3|RPIA_CYAP8 Ribose-5-phosphate isomerase A OS=Cyanothece sp. (strain PCC 8801) GN=rpiA PE=3 SV=1 15 247 1.0E-26
sp|B1XL11|RPIA_SYNP2 Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpiA PE=3 SV=1 11 247 1.0E-26
sp|Q8U1F0|RPIA_PYRFU Ribose-5-phosphate isomerase A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpiA PE=3 SV=1 10 245 3.0E-26
sp|A5GNH7|RPIA_SYNPW Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain WH7803) GN=rpiA PE=3 SV=1 7 245 2.0E-25
sp|A9BCI0|RPIA_PROM4 Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain MIT 9211) GN=rpiA PE=3 SV=1 8 245 5.0E-25
sp|Q8DJF2|RPIA_THEEB Ribose-5-phosphate isomerase A OS=Thermosynechococcus elongatus (strain BP-1) GN=rpiA PE=3 SV=1 6 245 7.0E-25
sp|Q7VA25|RPIA_PROMA Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpiA PE=3 SV=1 7 245 7.0E-25
sp|Q5UZD7|RPIA_HALMA Ribose-5-phosphate isomerase A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpiA PE=3 SV=1 7 248 1.0E-24
sp|Q9ZU38|RPI2_ARATH Probable ribose-5-phosphate isomerase 2 OS=Arabidopsis thaliana GN=RPI2 PE=1 SV=1 14 245 2.0E-24
sp|Q111U2|RPIA_TRIEI Ribose-5-phosphate isomerase A OS=Trichodesmium erythraeum (strain IMS101) GN=rpiA PE=3 SV=1 3 247 2.0E-24
sp|B8FL28|RPIA_DESAA Ribose-5-phosphate isomerase A OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpiA PE=3 SV=1 4 205 2.0E-24
sp|Q55766|RPIA_SYNY3 Ribose-5-phosphate isomerase A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpiA PE=3 SV=1 1 247 4.0E-24
sp|Q5JH26|RPIA_THEKO Ribose-5-phosphate isomerase A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpiA PE=3 SV=1 10 245 6.0E-24
sp|Q3M4J7|RPIA_ANAVT Ribose-5-phosphate isomerase A OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpiA PE=3 SV=1 11 245 1.0E-23
sp|Q8YYG2|RPIA_NOSS1 Ribose-5-phosphate isomerase A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpiA PE=3 SV=1 11 245 1.0E-23
sp|Q6LY04|RPIA_METMP Ribose-5-phosphate isomerase A OS=Methanococcus maripaludis (strain S2 / LL) GN=rpiA PE=3 SV=1 5 249 1.0E-23
sp|B7KIR2|RPIA_CYAP7 Ribose-5-phosphate isomerase A OS=Cyanothece sp. (strain PCC 7424) GN=rpiA PE=3 SV=1 29 247 2.0E-23
sp|A6UPJ0|RPIA_METVS Ribose-5-phosphate isomerase A OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpiA PE=3 SV=1 1 249 2.0E-23
sp|Q18E67|RPIA_HALWD Ribose-5-phosphate isomerase A OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpiA PE=3 SV=1 11 245 2.0E-23
sp|Q216Q6|RPIA_RHOPB Ribose-5-phosphate isomerase A OS=Rhodopseudomonas palustris (strain BisB18) GN=rpiA PE=3 SV=1 6 248 3.0E-23
sp|Q5N3J1|RPIA_SYNP6 Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpiA PE=3 SV=2 11 248 3.0E-23
sp|Q9C998|RPI1_ARATH Probable ribose-5-phosphate isomerase 1 OS=Arabidopsis thaliana GN=RPI1 PE=1 SV=1 11 248 4.0E-23
sp|A2C4N6|RPIA_PROM1 Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain NATL1A) GN=rpiA PE=3 SV=1 8 245 6.0E-23
sp|Q58998|RPIA_METJA Ribose-5-phosphate isomerase A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpiA PE=1 SV=1 11 249 9.0E-23
sp|A7I6S5|RPIA_METB6 Ribose-5-phosphate isomerase A OS=Methanoregula boonei (strain 6A8) GN=rpiA PE=3 SV=1 33 259 1.0E-22
sp|Q1MFT6|RPIA_RHIL3 Ribose-5-phosphate isomerase A OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpiA PE=3 SV=1 33 245 1.0E-22
sp|A5UXC5|RPIA_ROSS1 Ribose-5-phosphate isomerase A OS=Roseiflexus sp. (strain RS-1) GN=rpiA PE=3 SV=1 14 248 2.0E-22
sp|A7NNA4|RPIA_ROSCS Ribose-5-phosphate isomerase A OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpiA PE=3 SV=1 14 248 2.0E-22
sp|B8HN58|RPIA_CYAP4 Ribose-5-phosphate isomerase A OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpiA PE=3 SV=1 3 245 3.0E-22
sp|Q3ITP9|RPIA_NATPD Ribose-5-phosphate isomerase A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpiA PE=3 SV=1 10 248 3.0E-22
sp|Q46J18|RPIA_PROMT Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain NATL2A) GN=rpiA PE=3 SV=1 8 245 4.0E-22
sp|Q2K7M6|RPIA_RHIEC Ribose-5-phosphate isomerase A OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpiA PE=3 SV=1 33 245 4.0E-22
sp|B5ZRL6|RPIA_RHILW Ribose-5-phosphate isomerase A OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpiA PE=3 SV=1 33 245 5.0E-22
sp|Q9RW24|RPIA_DEIRA Ribose-5-phosphate isomerase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpiA PE=3 SV=1 10 248 6.0E-22
sp|B3PPZ4|RPIA_RHIE6 Ribose-5-phosphate isomerase A OS=Rhizobium etli (strain CIAT 652) GN=rpiA PE=3 SV=1 33 245 8.0E-22
sp|A4FWY7|RPIA_METM5 Ribose-5-phosphate isomerase A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpiA PE=3 SV=1 5 249 8.0E-22
sp|A6UUZ8|RPIA_META3 Ribose-5-phosphate isomerase A OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpiA PE=3 SV=1 18 249 9.0E-22
sp|A9AAC4|RPIA_METM6 Ribose-5-phosphate isomerase A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpiA PE=3 SV=1 5 249 9.0E-22
sp|A7HS32|RPIA_PARL1 Ribose-5-phosphate isomerase A OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpiA PE=3 SV=1 14 248 1.0E-21
sp|Q6L1K2|RPIA_PICTO Ribose-5-phosphate isomerase A OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpiA PE=3 SV=1 9 246 3.0E-21
sp|Q81CG8|RPIA_BACCR Ribose-5-phosphate isomerase A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpiA PE=3 SV=1 33 245 3.0E-21
sp|Q0I7L2|RPIA_SYNS3 Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain CC9311) GN=rpiA PE=3 SV=1 33 245 3.0E-21
sp|Q8UEZ0|RPIA_AGRFC Ribose-5-phosphate isomerase A OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpiA PE=3 SV=1 33 245 5.0E-21
sp|A6VGC9|RPIA_METM7 Ribose-5-phosphate isomerase A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpiA PE=3 SV=1 5 249 5.0E-21
sp|Q1GX07|RPIA_SPHAL Ribose-5-phosphate isomerase A OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpiA PE=3 SV=1 18 245 8.0E-21
sp|O29319|RPIA_ARCFU Ribose-5-phosphate isomerase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpiA PE=3 SV=1 18 234 8.0E-21
sp|Q8EN78|RPIA1_OCEIH Ribose-5-phosphate isomerase A 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpiA1 PE=3 SV=1 33 245 9.0E-21
sp|Q7V003|RPIA_PROMP Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpiA PE=3 SV=1 17 245 9.0E-21
sp|B9JFX9|RPIA_AGRRK Ribose-5-phosphate isomerase A OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpiA PE=3 SV=1 10 245 9.0E-21
sp|A9VID8|RPIA_BACWK Ribose-5-phosphate isomerase A OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpiA PE=3 SV=1 33 245 1.0E-20
sp|Q3AZA8|RPIA_SYNS9 Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain CC9902) GN=rpiA PE=3 SV=1 7 245 1.0E-20
sp|Q3AHX1|RPIA_SYNSC Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain CC9605) GN=rpiA PE=3 SV=1 7 245 1.0E-20
sp|Q736S8|RPIA_BACC1 Ribose-5-phosphate isomerase A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpiA PE=3 SV=1 33 245 1.0E-20
sp|Q7V5N8|RPIA_PROMM Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain MIT 9313) GN=rpiA PE=3 SV=1 33 245 1.0E-20
sp|A2C6S4|RPIA_PROM3 Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain MIT 9303) GN=rpiA PE=3 SV=1 33 245 2.0E-20
sp|Q2IUM8|RPIA_RHOP2 Ribose-5-phosphate isomerase A OS=Rhodopseudomonas palustris (strain HaA2) GN=rpiA PE=3 SV=1 16 248 2.0E-20
sp|Q73M68|RPIA_TREDE Ribose-5-phosphate isomerase A OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpiA PE=3 SV=1 33 245 3.0E-20
sp|Q7U8K8|RPIA_SYNPX Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain WH8102) GN=rpiA PE=3 SV=1 7 245 4.0E-20
sp|Q8P5S1|RPIA_XANCP Ribose-5-phosphate isomerase A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpiA PE=3 SV=1 13 245 4.0E-20
sp|B0RP81|RPIA_XANCB Ribose-5-phosphate isomerase A OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpiA PE=3 SV=1 13 245 4.0E-20
sp|Q4UYA0|RPIA_XANC8 Ribose-5-phosphate isomerase A OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpiA PE=3 SV=1 13 245 4.0E-20
sp|Q89NS9|RPIA_BRADU Ribose-5-phosphate isomerase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpiA PE=3 SV=1 8 248 5.0E-20
sp|P57961|RPIA_PASMU Ribose-5-phosphate isomerase A OS=Pasteurella multocida (strain Pm70) GN=rpiA PE=3 SV=1 25 245 5.0E-20
sp|Q92PB8|RPIA_RHIME Ribose-5-phosphate isomerase A OS=Rhizobium meliloti (strain 1021) GN=rpiA PE=3 SV=1 33 245 6.0E-20
sp|Q2JSC9|RPIA_SYNJA Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpiA PE=3 SV=1 33 248 7.0E-20
sp|Q0I101|RPIA_HAES1 Ribose-5-phosphate isomerase A OS=Haemophilus somnus (strain 129Pt) GN=rpiA PE=3 SV=1 12 237 7.0E-20
sp|Q81PL1|RPIA_BACAN Ribose-5-phosphate isomerase A OS=Bacillus anthracis GN=rpiA PE=3 SV=1 33 245 8.0E-20
sp|B0URT3|RPIA_HISS2 Ribose-5-phosphate isomerase A OS=Histophilus somni (strain 2336) GN=rpiA PE=3 SV=1 12 237 8.0E-20
sp|Q1LSJ4|RPIA_BAUCH Ribose-5-phosphate isomerase A OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpiA PE=3 SV=1 11 245 9.0E-20
sp|Q2P6P9|RPIA_XANOM Ribose-5-phosphate isomerase A OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpiA PE=3 SV=1 13 245 9.0E-20
sp|Q6HHU6|RPIA_BACHK Ribose-5-phosphate isomerase A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpiA PE=3 SV=1 33 245 9.0E-20
sp|A6U9T4|RPIA_SINMW Ribose-5-phosphate isomerase A OS=Sinorhizobium medicae (strain WSM419) GN=rpiA PE=3 SV=1 33 245 9.0E-20
sp|Q07Q53|RPIA_RHOP5 Ribose-5-phosphate isomerase A OS=Rhodopseudomonas palustris (strain BisA53) GN=rpiA PE=3 SV=1 6 248 9.0E-20
sp|Q8PH49|RPIA_XANAC Ribose-5-phosphate isomerase A OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpiA PE=3 SV=2 13 245 1.0E-19
sp|C4L7L6|RPIA_TOLAT Ribose-5-phosphate isomerase A OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpiA PE=3 SV=1 9 275 1.0E-19
sp|Q63AF7|RPIA_BACCZ Ribose-5-phosphate isomerase A OS=Bacillus cereus (strain ZK / E33L) GN=rpiA PE=3 SV=1 33 245 1.0E-19
sp|B1M272|RPIA_METRJ Ribose-5-phosphate isomerase A OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpiA PE=3 SV=1 33 266 1.0E-19
sp|Q0K980|RPIA_CUPNH Ribose-5-phosphate isomerase A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpiA PE=3 SV=1 15 245 1.0E-19
sp|B8F5R1|RPIA_HAEPS Ribose-5-phosphate isomerase A OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpiA PE=3 SV=1 8 224 2.0E-19
sp|Q139E9|RPIA_RHOPS Ribose-5-phosphate isomerase A OS=Rhodopseudomonas palustris (strain BisB5) GN=rpiA PE=3 SV=1 11 248 2.0E-19
sp|Q3BPQ4|RPIA_XANC5 Ribose-5-phosphate isomerase A OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpiA PE=3 SV=1 13 245 2.0E-19
sp|Q9S726|RPI3_ARATH Probable ribose-5-phosphate isomerase 3, chloroplastic OS=Arabidopsis thaliana GN=RPI3 PE=1 SV=1 14 248 2.0E-19
sp|A5UA25|RPIA_HAEIE Ribose-5-phosphate isomerase A OS=Haemophilus influenzae (strain PittEE) GN=rpiA PE=3 SV=1 8 224 2.0E-19
sp|B9JW57|RPIA_AGRVS Ribose-5-phosphate isomerase A OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpiA PE=3 SV=1 33 248 2.0E-19
sp|A5UGX5|RPIA_HAEIG Ribose-5-phosphate isomerase A OS=Haemophilus influenzae (strain PittGG) GN=rpiA PE=3 SV=1 15 224 3.0E-19
sp|B1L7D5|RPIA_KORCO Ribose-5-phosphate isomerase A OS=Korarchaeum cryptofilum (strain OPF8) GN=rpiA PE=3 SV=1 9 248 3.0E-19
sp|Q4QN79|RPIA_HAEI8 Ribose-5-phosphate isomerase A OS=Haemophilus influenzae (strain 86-028NP) GN=rpiA PE=3 SV=1 15 224 3.0E-19
sp|B2FT30|RPIA_STRMK Ribose-5-phosphate isomerase A OS=Stenotrophomonas maltophilia (strain K279a) GN=rpiA PE=3 SV=1 13 245 3.0E-19
sp|B4SI18|RPIA_STRM5 Ribose-5-phosphate isomerase A OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpiA PE=3 SV=1 13 245 3.0E-19
sp|Q5LTT5|RPIA_RUEPO Ribose-5-phosphate isomerase A OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpiA PE=3 SV=1 10 245 3.0E-19
sp|Q3J101|RPIA_RHOS4 Ribose-5-phosphate isomerase A OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpiA PE=3 SV=1 10 245 3.0E-19
sp|A5GVF8|RPIA_SYNR3 Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain RCC307) GN=rpiA PE=3 SV=1 7 248 3.0E-19
sp|B3QCR0|RPIA_RHOPT Ribose-5-phosphate isomerase A OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpiA PE=3 SV=1 11 248 3.0E-19
sp|Q6N8C3|RPIA_RHOPA Ribose-5-phosphate isomerase A OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpiA PE=3 SV=1 11 248 3.0E-19
sp|Q9PBX0|RPIA_XYLFA Ribose-5-phosphate isomerase A OS=Xylella fastidiosa (strain 9a5c) GN=rpiA PE=3 SV=2 13 245 4.0E-19
sp|Q98ML9|RPIA_RHILO Ribose-5-phosphate isomerase A OS=Rhizobium loti (strain MAFF303099) GN=rpiA PE=3 SV=1 33 248 4.0E-19
sp|B0BR42|RPIA_ACTPJ Ribose-5-phosphate isomerase A OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpiA PE=3 SV=1 9 224 4.0E-19
sp|Q87D89|RPIA_XYLFT Ribose-5-phosphate isomerase A OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpiA PE=3 SV=1 13 245 5.0E-19
sp|Q97AU2|RPIA_THEVO Ribose-5-phosphate isomerase A OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpiA PE=3 SV=1 11 248 5.0E-19
sp|P44725|RPIA_HAEIN Ribose-5-phosphate isomerase A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpiA PE=1 SV=1 15 224 5.0E-19
sp|Q493E8|RPIA_BLOPB Ribose-5-phosphate isomerase A OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpiA PE=3 SV=1 14 245 5.0E-19
sp|Q8G0S7|RPIA_BRUSU Ribose-5-phosphate isomerase A OS=Brucella suis biovar 1 (strain 1330) GN=rpiA PE=3 SV=1 10 248 5.0E-19
sp|B0U767|RPIA_XYLFM Ribose-5-phosphate isomerase A OS=Xylella fastidiosa (strain M12) GN=rpiA PE=3 SV=1 13 245 6.0E-19
sp|A6VQH4|RPIA_ACTSZ Ribose-5-phosphate isomerase A OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpiA PE=3 SV=1 8 237 7.0E-19
sp|A1A0A9|RPIA_BIFAA Ribose-5-phosphate isomerase A OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpiA PE=3 SV=1 14 245 7.0E-19
sp|B9KKA1|RPIA_RHOSK Ribose-5-phosphate isomerase A OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpiA PE=3 SV=1 10 245 8.0E-19
sp|A3PL91|RPIA_RHOS1 Ribose-5-phosphate isomerase A OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpiA PE=3 SV=1 10 245 1.0E-18
sp|A4WQX2|RPIA_RHOS5 Ribose-5-phosphate isomerase A OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpiA PE=3 SV=1 10 245 1.0E-18
sp|Q8YH30|RPIA_BRUME Ribose-5-phosphate isomerase A OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpiA PE=3 SV=2 10 245 1.0E-18
sp|C3MDE7|RPIA_RHISN Ribose-5-phosphate isomerase A OS=Rhizobium sp. (strain NGR234) GN=rpiA PE=3 SV=1 15 248 1.0E-18
sp|B9LU09|RPIA_HALLT Ribose-5-phosphate isomerase A OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpiA PE=3 SV=1 31 248 2.0E-18
sp|Q03SV2|RPIA_LACBA Ribose-5-phosphate isomerase A OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpiA PE=3 SV=1 11 245 2.0E-18
sp|B3R1I3|RPIA_CUPTR Ribose-5-phosphate isomerase A OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpiA PE=3 SV=1 15 245 2.0E-18
sp|Q318Q3|RPIA_PROM9 Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain MIT 9312) GN=rpiA PE=3 SV=1 17 245 2.0E-18
sp|B2VF17|RPIA_ERWT9 Ribose-5-phosphate isomerase A OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpiA PE=3 SV=1 14 213 3.0E-18
sp|Q7VP95|RPIA_HAEDU Ribose-5-phosphate isomerase A OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpiA PE=3 SV=1 9 224 3.0E-18
sp|Q48CC1|RPIA_PSE14 Ribose-5-phosphate isomerase A OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpiA PE=3 SV=1 15 199 3.0E-18
sp|Q83FB4|RPIA_COXBU Ribose-5-phosphate isomerase A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpiA PE=3 SV=1 14 264 3.0E-18
sp|A9NBF7|RPIA_COXBR Ribose-5-phosphate isomerase A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpiA PE=3 SV=1 14 264 3.0E-18
sp|A9KBD3|RPIA_COXBN Ribose-5-phosphate isomerase A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpiA PE=3 SV=1 14 264 3.0E-18
sp|B6J3K5|RPIA_COXB2 Ribose-5-phosphate isomerase A OS=Coxiella burnetii (strain CbuG_Q212) GN=rpiA PE=3 SV=1 14 264 3.0E-18
sp|B6J4C4|RPIA_COXB1 Ribose-5-phosphate isomerase A OS=Coxiella burnetii (strain CbuK_Q154) GN=rpiA PE=3 SV=1 14 264 3.0E-18
sp|Q5H3U0|RPIA_XANOR Ribose-5-phosphate isomerase A OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpiA PE=3 SV=2 13 245 3.0E-18
sp|B2SLM6|RPIA_XANOP Ribose-5-phosphate isomerase A OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpiA PE=3 SV=1 13 245 3.0E-18
sp|B1J2A2|RPIA_PSEPW Ribose-5-phosphate isomerase A OS=Pseudomonas putida (strain W619) GN=rpiA PE=3 SV=1 15 199 3.0E-18
sp|Q7VRG1|RPIA_BLOFL Ribose-5-phosphate isomerase A OS=Blochmannia floridanus GN=rpiA PE=3 SV=1 14 245 4.0E-18
sp|Q8Y013|RPIA_RALSO Ribose-5-phosphate isomerase A OS=Ralstonia solanacearum (strain GMI1000) GN=rpiA PE=3 SV=1 15 245 4.0E-18
sp|A1KUU8|RPIA_NEIMF Ribose-5-phosphate isomerase A OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpiA PE=3 SV=1 14 224 4.0E-18
sp|Q7WH03|RPIA_BORBR Ribose-5-phosphate isomerase A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpiA PE=3 SV=1 3 245 4.0E-18
sp|B0KP28|RPIA_PSEPG Ribose-5-phosphate isomerase A OS=Pseudomonas putida (strain GB-1) GN=rpiA PE=3 SV=1 15 199 4.0E-18
sp|B3H285|RPIA_ACTP7 Ribose-5-phosphate isomerase A OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpiA PE=3 SV=1 9 224 4.0E-18
sp|A3N2A1|RPIA_ACTP2 Ribose-5-phosphate isomerase A OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpiA PE=3 SV=1 9 224 4.0E-18
sp|Q086W4|RPIA_SHEFN Ribose-5-phosphate isomerase A OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpiA PE=3 SV=1 14 215 5.0E-18
sp|Q7W9Q5|RPIA_BORPA Ribose-5-phosphate isomerase A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpiA PE=3 SV=1 3 245 6.0E-18
sp|Q87UK7|RPIA_PSESM Ribose-5-phosphate isomerase A OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpiA PE=3 SV=1 15 199 7.0E-18
sp|Q2SN31|RPIA_HAHCH Ribose-5-phosphate isomerase A OS=Hahella chejuensis (strain KCTC 2396) GN=rpiA PE=3 SV=1 15 199 7.0E-18
sp|Q6LMP0|RPIA_PHOPR Ribose-5-phosphate isomerase A OS=Photobacterium profundum GN=rpiA PE=3 SV=1 14 245 7.0E-18
sp|Q5FQ98|RPIA_GLUOX Ribose-5-phosphate isomerase A OS=Gluconobacter oxydans (strain 621H) GN=rpiA PE=3 SV=1 14 245 7.0E-18
sp|Q1I3B8|RPIA_PSEE4 Ribose-5-phosphate isomerase A OS=Pseudomonas entomophila (strain L48) GN=rpiA PE=3 SV=1 15 199 8.0E-18
sp|Q9CDI7|RPIA_LACLA Ribose-5-phosphate isomerase A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpiA PE=3 SV=1 10 248 9.0E-18
sp|Q7VWC1|RPIA_BORPE Ribose-5-phosphate isomerase A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpiA PE=3 SV=1 3 245 1.0E-17
sp|B2S100|RPIA_BORHD Ribose-5-phosphate isomerase A OS=Borrelia hermsii (strain HS1 / DAH) GN=rpiA PE=3 SV=1 10 246 1.0E-17
sp|Q3K535|RPIA_PSEPF Ribose-5-phosphate isomerase A OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpiA PE=3 SV=1 15 199 1.0E-17
sp|Q9JTM5|RPIA_NEIMA Ribose-5-phosphate isomerase A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpiA PE=3 SV=1 14 224 1.0E-17
sp|A9M0U5|RPIA_NEIM0 Ribose-5-phosphate isomerase A OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpiA PE=3 SV=1 14 224 1.0E-17
sp|Q485H8|RPIA_COLP3 Ribose-5-phosphate isomerase A OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpiA PE=3 SV=1 14 199 1.0E-17
sp|C3K3R7|RPIA_PSEFS Ribose-5-phosphate isomerase A OS=Pseudomonas fluorescens (strain SBW25) GN=rpiA PE=3 SV=1 15 199 1.0E-17
sp|Q9JYM6|RPIA_NEIMB Ribose-5-phosphate isomerase A OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpiA PE=3 SV=1 14 224 1.0E-17
sp|Q65RQ9|RPIA_MANSM Ribose-5-phosphate isomerase A OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpiA PE=3 SV=1 15 237 1.0E-17
sp|Q72J47|RPIA_THET2 Ribose-5-phosphate isomerase A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpiA PE=1 SV=1 10 248 1.0E-17
sp|Q9HJT5|RPIA_THEAC Ribose-5-phosphate isomerase A OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpiA PE=3 SV=1 11 256 1.0E-17
sp|Q4ZLU8|RPIA_PSEU2 Ribose-5-phosphate isomerase A OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpiA PE=3 SV=1 15 199 1.0E-17
sp|A5EVM0|RPIA_DICNV Ribose-5-phosphate isomerase A OS=Dichelobacter nodosus (strain VCS1703A) GN=rpiA PE=3 SV=1 27 252 1.0E-17
sp|A5CXI2|RPIA_VESOH Ribose-5-phosphate isomerase A OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpiA PE=3 SV=1 20 199 2.0E-17
sp|Q5QVB3|RPIA_IDILO Ribose-5-phosphate isomerase A OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpiA PE=3 SV=1 33 245 2.0E-17
sp|B4F0Q0|RPIA_PROMH Ribose-5-phosphate isomerase A OS=Proteus mirabilis (strain HI4320) GN=rpiA PE=3 SV=1 14 245 2.0E-17
sp|Q88CN0|RPIA_PSEPK Ribose-5-phosphate isomerase A OS=Pseudomonas putida (strain KT2440) GN=rpiA PE=3 SV=1 15 199 2.0E-17
sp|A5WAL5|RPIA_PSEP1 Ribose-5-phosphate isomerase A OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpiA PE=3 SV=1 15 199 2.0E-17
sp|A1JPP4|RPIA_YERE8 Ribose-5-phosphate isomerase A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpiA PE=3 SV=1 14 245 2.0E-17
sp|Q129M0|RPIA_POLSJ Ribose-5-phosphate isomerase A OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpiA PE=3 SV=1 8 199 2.0E-17
sp|Q88YY5|RPIA_LACPL Ribose-5-phosphate isomerase A OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpiA PE=3 SV=1 33 245 3.0E-17
sp|Q66CS8|RPIA2_YERPS Ribose-5-phosphate isomerase A 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpiA2 PE=3 SV=1 7 245 3.0E-17
sp|Q8ZGJ9|RPIA2_YERPE Ribose-5-phosphate isomerase A 2 OS=Yersinia pestis GN=rpiA2 PE=3 SV=1 7 245 3.0E-17
sp|Q89AD5|RPIA_BUCBP Ribose-5-phosphate isomerase A OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpiA PE=3 SV=1 20 251 3.0E-17
sp|B2K0R4|RPIA_YERPB Ribose-5-phosphate isomerase A OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpiA PE=3 SV=1 14 245 3.0E-17
sp|Q666Q7|RPIA1_YERPS Ribose-5-phosphate isomerase A 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpiA1 PE=3 SV=1 14 245 3.0E-17
sp|Q8ZHH8|RPIA1_YERPE Ribose-5-phosphate isomerase A 1 OS=Yersinia pestis GN=rpiA1 PE=3 SV=1 14 245 3.0E-17
sp|Q5SIR5|RPIA_THET8 Ribose-5-phosphate isomerase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpiA PE=3 SV=1 10 248 3.0E-17
sp|B6JE08|RPIA_OLICO Ribose-5-phosphate isomerase A OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpiA PE=3 SV=1 33 248 4.0E-17
sp|Q9HN33|RPIA_HALSA Ribose-5-phosphate isomerase A OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpiA PE=3 SV=1 32 248 4.0E-17
sp|B0R7H0|RPIA_HALS3 Ribose-5-phosphate isomerase A OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpiA PE=3 SV=1 32 248 4.0E-17
sp|Q2KYQ1|RPIA_BORA1 Ribose-5-phosphate isomerase A OS=Bordetella avium (strain 197N) GN=rpiA PE=3 SV=1 32 245 4.0E-17
sp|Q8D252|RPIA_WIGBR Ribose-5-phosphate isomerase A OS=Wigglesworthia glossinidia brevipalpis GN=rpiA PE=3 SV=1 11 245 4.0E-17
sp|Q03E35|RPIA_PEDPA Ribose-5-phosphate isomerase A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpiA PE=3 SV=1 33 245 5.0E-17
sp|B2S3K6|RPIA_TREPS Ribose-5-phosphate isomerase A OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpiA PE=3 SV=1 5 283 5.0E-17
sp|O83625|RPIA_TREPA Ribose-5-phosphate isomerase A OS=Treponema pallidum (strain Nichols) GN=rpiA PE=3 SV=1 5 283 5.0E-17
sp|C5BMC8|RPIA_TERTT Ribose-5-phosphate isomerase A OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpiA PE=3 SV=1 15 199 6.0E-17
sp|Q8K9E2|RPIA_BUCAP Ribose-5-phosphate isomerase A OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpiA PE=3 SV=1 8 260 6.0E-17
sp|A0KLT5|RPIA_AERHH Ribose-5-phosphate isomerase A OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpiA PE=3 SV=1 14 199 7.0E-17
sp|Q2NRE0|RPIA_SODGM Ribose-5-phosphate isomerase A OS=Sodalis glossinidius (strain morsitans) GN=rpiA PE=3 SV=1 14 245 8.0E-17
sp|C6DF34|RPIA_PECCP Ribose-5-phosphate isomerase A OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpiA PE=3 SV=1 14 245 1.0E-16
sp|B4RL16|RPIA_NEIG2 Ribose-5-phosphate isomerase A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpiA PE=3 SV=1 14 224 1.0E-16
sp|Q5F831|RPIA_NEIG1 Ribose-5-phosphate isomerase A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpiA PE=3 SV=1 14 224 1.0E-16
sp|B0VQK6|RPIA_ACIBS Ribose-5-phosphate isomerase A OS=Acinetobacter baumannii (strain SDF) GN=rpiA PE=3 SV=1 27 245 1.0E-16
sp|O52398|RPIA_EDWI9 Ribose-5-phosphate isomerase A OS=Edwardsiella ictaluri (strain 93-146) GN=rpiA PE=3 SV=1 14 245 2.0E-16
sp|Q6GE99|RPIA_STAAR Ribose-5-phosphate isomerase A OS=Staphylococcus aureus (strain MRSA252) GN=rpiA PE=3 SV=1 33 204 2.0E-16
sp|Q4K469|RPIA_PSEF5 Ribose-5-phosphate isomerase A OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpiA PE=3 SV=1 15 199 2.0E-16
sp|Q8EMZ1|RPIA2_OCEIH Ribose-5-phosphate isomerase A 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpiA2 PE=3 SV=1 14 245 2.0E-16
sp|Q0ACJ4|RPIA_ALKEH Ribose-5-phosphate isomerase A OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpiA PE=3 SV=1 15 245 2.0E-16
sp|Q1GF74|RPIA_RUEST Ribose-5-phosphate isomerase A OS=Ruegeria sp. (strain TM1040) GN=rpiA PE=3 SV=1 6 245 2.0E-16
sp|A8H0Q6|RPIA_SHEPA Ribose-5-phosphate isomerase A OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpiA PE=3 SV=1 14 217 2.0E-16
sp|Q9I6G1|RPIA_PSEAE Ribose-5-phosphate isomerase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpiA PE=1 SV=1 15 201 2.0E-16
sp|Q02U86|RPIA_PSEAB Ribose-5-phosphate isomerase A OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpiA PE=3 SV=1 15 201 2.0E-16
sp|B7V2P3|RPIA_PSEA8 Ribose-5-phosphate isomerase A OS=Pseudomonas aeruginosa (strain LESB58) GN=rpiA PE=3 SV=1 15 201 2.0E-16
sp|A1SSJ0|RPIA_PSYIN Ribose-5-phosphate isomerase A OS=Psychromonas ingrahamii (strain 37) GN=rpiA PE=3 SV=1 14 215 2.0E-16
sp|B2T3F4|RPIA_BURPP Ribose-5-phosphate isomerase A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpiA PE=3 SV=1 20 245 2.0E-16
sp|Q0VL94|RPIA_ALCBS Ribose-5-phosphate isomerase A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpiA PE=3 SV=1 14 199 3.0E-16
sp|A4SYB4|RPIA_POLSQ Ribose-5-phosphate isomerase A OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpiA PE=3 SV=1 21 199 3.0E-16
sp|A1U689|RPIA_MARHV Ribose-5-phosphate isomerase A OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpiA PE=3 SV=1 6 199 3.0E-16
sp|A4SLF3|RPIA_AERS4 Ribose-5-phosphate isomerase A OS=Aeromonas salmonicida (strain A449) GN=rpiA PE=3 SV=1 14 199 3.0E-16
sp|P66696|RPIA_STAAW Ribose-5-phosphate isomerase A OS=Staphylococcus aureus (strain MW2) GN=rpiA PE=3 SV=1 33 204 3.0E-16
sp|Q6G6Y5|RPIA_STAAS Ribose-5-phosphate isomerase A OS=Staphylococcus aureus (strain MSSA476) GN=rpiA PE=3 SV=1 33 204 3.0E-16
sp|P66695|RPIA_STAAN Ribose-5-phosphate isomerase A OS=Staphylococcus aureus (strain N315) GN=rpiA PE=3 SV=1 33 204 3.0E-16
sp|P66694|RPIA_STAAM Ribose-5-phosphate isomerase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpiA PE=3 SV=1 33 204 3.0E-16
sp|Q21WC3|RPIA_RHOFT Ribose-5-phosphate isomerase A OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpiA PE=3 SV=1 20 199 3.0E-16
sp|Q5HDM1|RPIA_STAAC Ribose-5-phosphate isomerase A OS=Staphylococcus aureus (strain COL) GN=rpiA PE=3 SV=1 33 204 4.0E-16
sp|A4G433|RPIA_HERAR Ribose-5-phosphate isomerase A OS=Herminiimonas arsenicoxydans GN=rpiA PE=3 SV=1 9 199 4.0E-16
sp|A2SHQ1|RPIA_METPP Ribose-5-phosphate isomerase A OS=Methylibium petroleiphilum (strain PM1) GN=rpiA PE=3 SV=1 20 199 4.0E-16
sp|A6UYD2|RPIA_PSEA7 Ribose-5-phosphate isomerase A OS=Pseudomonas aeruginosa (strain PA7) GN=rpiA PE=3 SV=1 15 201 4.0E-16
sp|P66692|RPIA_SALTY Ribose-5-phosphate isomerase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|P66693|RPIA_SALTI Ribose-5-phosphate isomerase A OS=Salmonella typhi GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|B5BFM8|RPIA_SALPK Ribose-5-phosphate isomerase A OS=Salmonella paratyphi A (strain AKU_12601) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|C0PY37|RPIA_SALPC Ribose-5-phosphate isomerase A OS=Salmonella paratyphi C (strain RKS4594) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|A9N3P6|RPIA_SALPB Ribose-5-phosphate isomerase A OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|Q5PJH1|RPIA_SALPA Ribose-5-phosphate isomerase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|B5RE24|RPIA_SALG2 Ribose-5-phosphate isomerase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|B5QXJ0|RPIA_SALEP Ribose-5-phosphate isomerase A OS=Salmonella enteritidis PT4 (strain P125109) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|Q57K52|RPIA_SALCH Ribose-5-phosphate isomerase A OS=Salmonella choleraesuis (strain SC-B67) GN=rpiA PE=3 SV=1 14 275 5.0E-16
sp|A4VGK9|RPIA_PSEU5 Ribose-5-phosphate isomerase A OS=Pseudomonas stutzeri (strain A1501) GN=rpiA PE=3 SV=1 15 199 6.0E-16
sp|Q13ZQ5|RPIA_BURXL Ribose-5-phosphate isomerase A OS=Burkholderia xenovorans (strain LB400) GN=rpiA PE=3 SV=1 20 245 6.0E-16
sp|B1XU95|RPIA_POLNS Ribose-5-phosphate isomerase A OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpiA PE=3 SV=1 20 199 6.0E-16
sp|A3M5Z8|RPIA_ACIBT Ribose-5-phosphate isomerase A OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpiA PE=3 SV=2 27 245 7.0E-16
sp|Q6D093|RPIA_PECAS Ribose-5-phosphate isomerase A OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpiA PE=3 SV=1 14 245 7.0E-16
sp|A1AFA2|RPIA_ECOK1 Ribose-5-phosphate isomerase A OS=Escherichia coli O1:K1 / APEC GN=rpiA PE=3 SV=1 2 245 7.0E-16
sp|Q3YXV7|RPIA_SHISS Ribose-5-phosphate isomerase A OS=Shigella sonnei (strain Ss046) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|P0A7Z3|RPIA_SHIFL Ribose-5-phosphate isomerase A OS=Shigella flexneri GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|Q0T0Y5|RPIA_SHIF8 Ribose-5-phosphate isomerase A OS=Shigella flexneri serotype 5b (strain 8401) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|Q32BX5|RPIA_SHIDS Ribose-5-phosphate isomerase A OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|Q31WH4|RPIA_SHIBS Ribose-5-phosphate isomerase A OS=Shigella boydii serotype 4 (strain Sb227) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B2U0T0|RPIA_SHIB3 Ribose-5-phosphate isomerase A OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B1LDB5|RPIA_ECOSM Ribose-5-phosphate isomerase A OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B6I746|RPIA_ECOSE Ribose-5-phosphate isomerase A OS=Escherichia coli (strain SE11) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7N7F6|RPIA_ECOLU Ribose-5-phosphate isomerase A OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|P0A7Z0|RPIA_ECOLI Ribose-5-phosphate isomerase A OS=Escherichia coli (strain K12) GN=rpiA PE=1 SV=1 14 275 8.0E-16
sp|B1IT89|RPIA_ECOLC Ribose-5-phosphate isomerase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|P0A7Z1|RPIA_ECOL6 Ribose-5-phosphate isomerase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|A8A454|RPIA_ECOHS Ribose-5-phosphate isomerase A OS=Escherichia coli O9:H4 (strain HS) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B1XEJ9|RPIA_ECODH Ribose-5-phosphate isomerase A OS=Escherichia coli (strain K12 / DH10B) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|C5A0I5|RPIA_ECOBW Ribose-5-phosphate isomerase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7LYT1|RPIA_ECO8A Ribose-5-phosphate isomerase A OS=Escherichia coli O8 (strain IAI1) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7MZL0|RPIA_ECO81 Ribose-5-phosphate isomerase A OS=Escherichia coli O81 (strain ED1a) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7NHX4|RPIA_ECO7I Ribose-5-phosphate isomerase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B5YQA8|RPIA_ECO5E Ribose-5-phosphate isomerase A OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|P0A7Z2|RPIA_ECO57 Ribose-5-phosphate isomerase A OS=Escherichia coli O157:H7 GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7LFH2|RPIA_ECO55 Ribose-5-phosphate isomerase A OS=Escherichia coli (strain 55989 / EAEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7MM99|RPIA_ECO45 Ribose-5-phosphate isomerase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|B7UHW1|RPIA_ECO27 Ribose-5-phosphate isomerase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|A7ZR23|RPIA_ECO24 Ribose-5-phosphate isomerase A OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpiA PE=3 SV=1 14 275 8.0E-16
sp|A1K9D7|RPIA_AZOSB Ribose-5-phosphate isomerase A OS=Azoarcus sp. (strain BH72) GN=rpiA PE=3 SV=1 32 199 9.0E-16
sp|Q822P7|RPIA_CHLCV Ribose-5-phosphate isomerase A OS=Chlamydophila caviae (strain GPIC) GN=rpiA PE=3 SV=1 13 203 9.0E-16
sp|B0V681|RPIA_ACIBY Ribose-5-phosphate isomerase A OS=Acinetobacter baumannii (strain AYE) GN=rpiA PE=3 SV=1 27 245 9.0E-16
sp|B2I2V7|RPIA_ACIBC Ribose-5-phosphate isomerase A OS=Acinetobacter baumannii (strain ACICU) GN=rpiA PE=3 SV=1 27 245 9.0E-16
sp|B7I936|RPIA_ACIB5 Ribose-5-phosphate isomerase A OS=Acinetobacter baumannii (strain AB0057) GN=rpiA PE=3 SV=1 27 245 9.0E-16
sp|B7H207|RPIA_ACIB3 Ribose-5-phosphate isomerase A OS=Acinetobacter baumannii (strain AB307-0294) GN=rpiA PE=3 SV=1 27 245 9.0E-16
sp|B2U9W6|RPIA_RALPJ Ribose-5-phosphate isomerase A OS=Ralstonia pickettii (strain 12J) GN=rpiA PE=3 SV=1 15 245 9.0E-16
sp|B8D7U4|RPIA_BUCAT Ribose-5-phosphate isomerase A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpiA PE=3 SV=1 24 251 9.0E-16
sp|P57489|RPIA_BUCAI Ribose-5-phosphate isomerase A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpiA PE=3 SV=1 24 251 9.0E-16
sp|B8D9J2|RPIA_BUCA5 Ribose-5-phosphate isomerase A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpiA PE=3 SV=1 24 251 9.0E-16
sp|Q21F87|RPIA_SACD2 Ribose-5-phosphate isomerase A OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpiA PE=3 SV=1 15 199 1.0E-15
sp|B9LCG3|RPIA_CHLSY Ribose-5-phosphate isomerase A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpiA PE=3 SV=1 33 251 1.0E-15
sp|A9WIA0|RPIA_CHLAA Ribose-5-phosphate isomerase A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpiA PE=3 SV=1 33 251 1.0E-15
sp|Q7MHL9|RPIA_VIBVY Ribose-5-phosphate isomerase A OS=Vibrio vulnificus (strain YJ016) GN=rpiA PE=1 SV=2 14 245 1.0E-15
sp|B7LPC8|RPIA_ESCF3 Ribose-5-phosphate isomerase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpiA PE=3 SV=1 14 245 1.0E-15
sp|A6T0F1|RPIA_JANMA Ribose-5-phosphate isomerase A OS=Janthinobacterium sp. (strain Marseille) GN=rpiA PE=3 SV=1 9 245 1.0E-15
sp|B1Y3C2|RPIA_LEPCP Ribose-5-phosphate isomerase A OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpiA PE=3 SV=1 15 199 1.0E-15
sp|Q8RLY6|RPIA_ENTCL Ribose-5-phosphate isomerase A OS=Enterobacter cloacae GN=rpiA PE=3 SV=1 14 245 1.0E-15
sp|Q254Z5|RPIA_CHLFF Ribose-5-phosphate isomerase A OS=Chlamydophila felis (strain Fe/C-56) GN=rpiA PE=3 SV=1 13 205 2.0E-15
sp|A9MRG2|RPIA_SALAR Ribose-5-phosphate isomerase A OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpiA PE=3 SV=1 14 245 2.0E-15
sp|A6WRS7|RPIA_SHEB8 Ribose-5-phosphate isomerase A OS=Shewanella baltica (strain OS185) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|Q8DC93|RPIA_VIBVU Ribose-5-phosphate isomerase A OS=Vibrio vulnificus (strain CMCP6) GN=rpiA PE=3 SV=2 14 245 2.0E-15
sp|Q5L5N7|RPIA_CHLAB Ribose-5-phosphate isomerase A OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpiA PE=3 SV=1 14 203 2.0E-15
sp|A4Y9L3|RPIA_SHEPC Ribose-5-phosphate isomerase A OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|A1RGR8|RPIA_SHESW Ribose-5-phosphate isomerase A OS=Shewanella sp. (strain W3-18-1) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|A2RP28|RPIA_LACLM Ribose-5-phosphate isomerase A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpiA PE=3 SV=1 10 248 2.0E-15
sp|Q12Q96|RPIA_SHEDO Ribose-5-phosphate isomerase A OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|Q7N189|RPIA_PHOLL Ribose-5-phosphate isomerase A OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpiA PE=3 SV=1 14 245 2.0E-15
sp|A9L0P5|RPIA_SHEB9 Ribose-5-phosphate isomerase A OS=Shewanella baltica (strain OS195) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|A3D7R0|RPIA_SHEB5 Ribose-5-phosphate isomerase A OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|B8E4U3|RPIA_SHEB2 Ribose-5-phosphate isomerase A OS=Shewanella baltica (strain OS223) GN=rpiA PE=3 SV=1 14 199 2.0E-15
sp|Q034H8|RPIA_LACC3 Ribose-5-phosphate isomerase A OS=Lactobacillus casei (strain ATCC 334) GN=rpiA PE=3 SV=1 11 245 3.0E-15
sp|Q8G3X9|RPIA_BIFLO Ribose-5-phosphate isomerase A OS=Bifidobacterium longum (strain NCC 2705) GN=rpiA PE=3 SV=1 14 245 3.0E-15
sp|B7GN96|RPIA_BIFLS Ribose-5-phosphate isomerase A OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpiA PE=3 SV=1 14 245 3.0E-15
sp|B1KFT2|RPIA_SHEWM Ribose-5-phosphate isomerase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpiA PE=3 SV=1 14 199 3.0E-15
sp|B5ENJ5|RPIA_ACIF5 Ribose-5-phosphate isomerase A OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpiA PE=3 SV=1 14 224 3.0E-15
sp|B7J5S6|RPIA_ACIF2 Ribose-5-phosphate isomerase A OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpiA PE=3 SV=1 14 224 3.0E-15
sp|Q60BV9|RPIA_METCA Ribose-5-phosphate isomerase A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpiA PE=3 SV=1 11 199 3.0E-15
sp|Q8Y8D3|RPIA_LISMO Ribose-5-phosphate isomerase A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpiA PE=3 SV=1 33 245 3.0E-15
sp|A1AVQ5|RPIA_RUTMC Ribose-5-phosphate isomerase A OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpiA PE=3 SV=1 4 199 4.0E-15
sp|B2G5S0|RPIA_LACRJ Ribose-5-phosphate isomerase A OS=Lactobacillus reuteri (strain JCM 1112) GN=rpiA PE=3 SV=1 27 245 4.0E-15
sp|A5VI94|RPIA_LACRD Ribose-5-phosphate isomerase A OS=Lactobacillus reuteri (strain DSM 20016) GN=rpiA PE=3 SV=1 27 245 4.0E-15
sp|A9W537|RPIA_METEP Ribose-5-phosphate isomerase A OS=Methylobacterium extorquens (strain PA1) GN=rpiA PE=3 SV=1 14 247 5.0E-15
sp|Q1QN95|RPIA_NITHX Ribose-5-phosphate isomerase A OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpiA PE=3 SV=1 10 248 5.0E-15
sp|Q168R5|RPIA_ROSDO Ribose-5-phosphate isomerase A OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpiA PE=3 SV=1 6 245 5.0E-15
sp|B8CJW7|RPIA_SHEPW Ribose-5-phosphate isomerase A OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpiA PE=3 SV=1 14 245 6.0E-15
sp|B5FAI8|RPIA_VIBFM Ribose-5-phosphate isomerase A OS=Vibrio fischeri (strain MJ11) GN=rpiA PE=3 SV=1 14 245 6.0E-15
sp|Q5E2Z6|RPIA_VIBF1 Ribose-5-phosphate isomerase A OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpiA PE=3 SV=1 14 245 6.0E-15
sp|Q839H2|RPIA_ENTFA Ribose-5-phosphate isomerase A OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpiA PE=3 SV=1 32 245 7.0E-15
sp|C1D560|RPIA_LARHH Ribose-5-phosphate isomerase A OS=Laribacter hongkongensis (strain HLHK9) GN=rpiA PE=3 SV=1 24 199 8.0E-15
sp|Q6FCI6|RPIA_ACIAD Ribose-5-phosphate isomerase A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpiA PE=3 SV=1 27 245 9.0E-15
sp|B3DQF7|RPIA_BIFLD Ribose-5-phosphate isomerase A OS=Bifidobacterium longum (strain DJO10A) GN=rpiA PE=3 SV=1 14 245 9.0E-15
sp|C3LR22|RPIA_VIBCM Ribose-5-phosphate isomerase A OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpiA PE=3 SV=1 14 245 1.0E-14
sp|Q9KP93|RPIA_VIBCH Ribose-5-phosphate isomerase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpiA PE=3 SV=1 14 245 1.0E-14
sp|A5F5G0|RPIA_VIBC3 Ribose-5-phosphate isomerase A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpiA PE=3 SV=1 14 245 1.0E-14
sp|A8AXN9|RPIA_STRGC Ribose-5-phosphate isomerase A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpiA PE=3 SV=1 10 246 1.0E-14
sp|Q045B8|RPIA_LACGA Ribose-5-phosphate isomerase A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpiA PE=3 SV=1 14 245 1.0E-14
sp|B1Z896|RPIA_METPB Ribose-5-phosphate isomerase A OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpiA PE=3 SV=1 14 258 1.0E-14
sp|Q0HXZ4|RPIA_SHESR Ribose-5-phosphate isomerase A OS=Shewanella sp. (strain MR-7) GN=rpiA PE=3 SV=1 14 199 1.0E-14
sp|Q0HLL3|RPIA_SHESM Ribose-5-phosphate isomerase A OS=Shewanella sp. (strain MR-4) GN=rpiA PE=3 SV=1 14 199 1.0E-14
sp|A0KTU4|RPIA_SHESA Ribose-5-phosphate isomerase A OS=Shewanella sp. (strain ANA-3) GN=rpiA PE=3 SV=1 14 199 1.0E-14
sp|A9IJV4|RPIA_BORPD Ribose-5-phosphate isomerase A OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpiA PE=3 SV=1 32 201 1.0E-14
sp|Q8EHR7|RPIA_SHEON Ribose-5-phosphate isomerase A OS=Shewanella oneidensis (strain MR-1) GN=rpiA PE=3 SV=1 14 199 1.0E-14
sp|Q63TU6|RPIA_BURPS Ribose-5-phosphate isomerase A OS=Burkholderia pseudomallei (strain K96243) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|A3N919|RPIA_BURP6 Ribose-5-phosphate isomerase A OS=Burkholderia pseudomallei (strain 668) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|Q3JST3|RPIA_BURP1 Ribose-5-phosphate isomerase A OS=Burkholderia pseudomallei (strain 1710b) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|A3NUR6|RPIA_BURP0 Ribose-5-phosphate isomerase A OS=Burkholderia pseudomallei (strain 1106a) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|A1V4B2|RPIA_BURMS Ribose-5-phosphate isomerase A OS=Burkholderia mallei (strain SAVP1) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|Q62K38|RPIA_BURMA Ribose-5-phosphate isomerase A OS=Burkholderia mallei (strain ATCC 23344) GN=rpiA PE=3 SV=2 4 245 2.0E-14
sp|A2S2I6|RPIA_BURM9 Ribose-5-phosphate isomerase A OS=Burkholderia mallei (strain NCTC 10229) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|A3MJY8|RPIA_BURM7 Ribose-5-phosphate isomerase A OS=Burkholderia mallei (strain NCTC 10247) GN=rpiA PE=3 SV=1 4 245 2.0E-14
sp|A6TDS5|RPIA_KLEP7 Ribose-5-phosphate isomerase A OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpiA PE=3 SV=1 14 245 2.0E-14
sp|Q02VQ6|RPIA_LACLS Ribose-5-phosphate isomerase A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpiA PE=3 SV=1 10 246 2.0E-14
sp|A4JE17|RPIA_BURVG Ribose-5-phosphate isomerase A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpiA PE=3 SV=1 20 245 2.0E-14
sp|Q15Q28|RPIA_PSEA6 Ribose-5-phosphate isomerase A OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpiA PE=3 SV=1 14 215 2.0E-14
sp|Q74KF3|RPIA_LACJO Ribose-5-phosphate isomerase A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpiA PE=3 SV=1 33 245 2.0E-14
sp|Q46ZK1|RPIA_CUPPJ Ribose-5-phosphate isomerase A OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpiA PE=3 SV=1 15 245 2.0E-14
sp|B5XUC4|RPIA_KLEP3 Ribose-5-phosphate isomerase A OS=Klebsiella pneumoniae (strain 342) GN=rpiA PE=3 SV=1 14 245 2.0E-14
sp|B6EKP6|RPIA_ALISL Ribose-5-phosphate isomerase A OS=Aliivibrio salmonicida (strain LFI1238) GN=rpiA PE=3 SV=1 14 245 3.0E-14
sp|B7L2C9|RPIA_METC4 Ribose-5-phosphate isomerase A OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpiA PE=3 SV=1 14 247 3.0E-14
sp|Q82TX6|RPIA_NITEU Ribose-5-phosphate isomerase A OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpiA PE=3 SV=1 9 199 3.0E-14
sp|Q92D46|RPIA_LISIN Ribose-5-phosphate isomerase A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpiA PE=3 SV=1 33 245 3.0E-14
sp|Q8DZC6|RPIA_STRA5 Ribose-5-phosphate isomerase A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpiA PE=3 SV=1 14 248 3.0E-14
sp|A8FRN6|RPIA_SHESH Ribose-5-phosphate isomerase A OS=Shewanella sediminis (strain HAW-EB3) GN=rpiA PE=3 SV=1 14 199 3.0E-14
sp|A8LIN0|RPIA_DINSH Ribose-5-phosphate isomerase A OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpiA PE=3 SV=1 10 245 3.0E-14
sp|Q31FB3|RPIA_THICR Ribose-5-phosphate isomerase A OS=Thiomicrospira crunogena (strain XCL-2) GN=rpiA PE=3 SV=1 14 251 3.0E-14
sp|Q0BFR5|RPIA_BURCM Ribose-5-phosphate isomerase A OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpiA PE=3 SV=1 20 245 4.0E-14
sp|A3QB49|RPIA_SHELP Ribose-5-phosphate isomerase A OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpiA PE=3 SV=1 14 215 4.0E-14
sp|Q4L8J6|RPIA_STAHJ Ribose-5-phosphate isomerase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpiA PE=3 SV=1 33 202 4.0E-14
sp|Q8CRC8|RPIA_STAES Ribose-5-phosphate isomerase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpiA PE=3 SV=1 33 245 5.0E-14
sp|Q5HLQ9|RPIA_STAEQ Ribose-5-phosphate isomerase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpiA PE=3 SV=1 33 245 5.0E-14
sp|Q7NPM5|RPIA_GLOVI Ribose-5-phosphate isomerase A OS=Gloeobacter violaceus (strain PCC 7421) GN=rpiA PE=3 SV=1 14 248 5.0E-14
sp|Q0TDT9|RPIA_ECOL5 Ribose-5-phosphate isomerase A OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpiA PE=3 SV=1 2 199 5.0E-14
sp|B1YPI1|RPIA_BURA4 Ribose-5-phosphate isomerase A OS=Burkholderia ambifaria (strain MC40-6) GN=rpiA PE=3 SV=1 20 245 6.0E-14
sp|Q39GY0|RPIA_BURL3 Ribose-5-phosphate isomerase A OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpiA PE=3 SV=1 20 245 6.0E-14
sp|A1S982|RPIA_SHEAM Ribose-5-phosphate isomerase A OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpiA PE=3 SV=1 32 217 6.0E-14
sp|A6W2V3|RPIA_MARMS Ribose-5-phosphate isomerase A OS=Marinomonas sp. (strain MWYL1) GN=rpiA PE=3 SV=1 15 215 7.0E-14
sp|Q03KJ8|RPIA_STRTD Ribose-5-phosphate isomerase A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpiA PE=3 SV=1 33 248 7.0E-14
sp|Q5M481|RPIA_STRT2 Ribose-5-phosphate isomerase A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpiA PE=3 SV=1 33 248 7.0E-14
sp|Q5P7L9|RPIA_AROAE Ribose-5-phosphate isomerase A OS=Aromatoleum aromaticum (strain EbN1) GN=rpiA PE=3 SV=1 32 199 1.0E-13
sp|C1L1P6|RPIA_LISMC Ribose-5-phosphate isomerase A OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpiA PE=3 SV=1 33 245 1.0E-13
sp|O51601|RPIA_BORBU Ribose-5-phosphate isomerase A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpiA PE=3 SV=1 10 246 1.0E-13
sp|Q5LZM5|RPIA_STRT1 Ribose-5-phosphate isomerase A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpiA PE=3 SV=1 33 248 1.0E-13
sp|Q721J0|RPIA_LISMF Ribose-5-phosphate isomerase A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpiA PE=3 SV=1 33 245 2.0E-13
sp|Q8E4Y6|RPIA_STRA3 Ribose-5-phosphate isomerase A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpiA PE=3 SV=1 33 246 2.0E-13
sp|B9DUK4|RPIA_STRU0 Ribose-5-phosphate isomerase A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpiA PE=3 SV=1 10 199 2.0E-13
sp|Q6FZP1|RPIA_BARQU Ribose-5-phosphate isomerase A OS=Bartonella quintana (strain Toulouse) GN=rpiA PE=3 SV=1 10 283 2.0E-13
sp|Q3K0S0|RPIA_STRA1 Ribose-5-phosphate isomerase A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpiA PE=3 SV=1 32 248 2.0E-13
sp|B1YEE3|RPIA_EXIS2 Ribose-5-phosphate isomerase A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpiA PE=3 SV=1 9 245 3.0E-13
sp|Q7NYL4|RPIA_CHRVO Ribose-5-phosphate isomerase A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpiA PE=3 SV=1 13 199 3.0E-13
sp|Q0AR22|RPIA_MARMM Ribose-5-phosphate isomerase A OS=Maricaulis maris (strain MCS10) GN=rpiA PE=3 SV=1 14 245 3.0E-13
sp|B7J2L2|RPIA_BORBZ Ribose-5-phosphate isomerase A OS=Borrelia burgdorferi (strain ZS7) GN=rpiA PE=3 SV=1 10 246 3.0E-13
sp|Q3J7S6|RPIA_NITOC Ribose-5-phosphate isomerase A OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpiA PE=3 SV=1 15 251 3.0E-13
sp|Q87LL9|RPIA_VIBPA Ribose-5-phosphate isomerase A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpiA PE=3 SV=1 14 245 3.0E-13
sp|B9KYD3|RPIA_THERP Ribose-5-phosphate isomerase A OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpiA PE=3 SV=1 10 245 4.0E-13
sp|B8G2V0|RPIA_CHLAD Ribose-5-phosphate isomerase A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpiA PE=3 SV=1 33 251 5.0E-13
sp|Q28MH0|RPIA_JANSC Ribose-5-phosphate isomerase A OS=Jannaschia sp. (strain CCS1) GN=rpiA PE=3 SV=1 10 245 7.0E-13
sp|A4VWC6|RPIA_STRSY Ribose-5-phosphate isomerase A OS=Streptococcus suis (strain 05ZYH33) GN=rpiA PE=3 SV=1 33 248 7.0E-13
sp|A4W2M7|RPIA_STRS2 Ribose-5-phosphate isomerase A OS=Streptococcus suis (strain 98HAH33) GN=rpiA PE=3 SV=1 33 248 7.0E-13
sp|B1IAZ7|RPIA_STRPI Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpiA PE=3 SV=1 10 246 7.0E-13
sp|Q6G3V6|RPIA_BARHE Ribose-5-phosphate isomerase A OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpiA PE=1 SV=1 10 248 9.0E-13
sp|Q9PKI0|RPIA_CHLMU Ribose-5-phosphate isomerase A OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpiA PE=3 SV=1 33 203 9.0E-13
sp|C1CDH6|RPIA_STRZJ Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain JJA) GN=rpiA PE=3 SV=1 10 246 9.0E-13
sp|B8ZNH8|RPIA_STRPJ Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpiA PE=3 SV=1 10 246 9.0E-13
sp|A0Q756|RPIA_FRATN Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. novicida (strain U112) GN=rpiA PE=3 SV=1 14 199 1.0E-12
sp|B7VK98|RPIA_VIBTL Ribose-5-phosphate isomerase A OS=Vibrio tasmaniensis (strain LGP32) GN=rpiA PE=3 SV=1 14 199 1.0E-12
sp|Q3STA8|RPIA_NITWN Ribose-5-phosphate isomerase A OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpiA PE=3 SV=1 6 248 1.0E-12
sp|A4IYN5|RPIA_FRATW Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpiA PE=1 SV=1 14 199 1.0E-12
sp|Q5NFM5|RPIA_FRATT Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpiA PE=1 SV=1 14 199 1.0E-12
sp|B2SG83|RPIA_FRATM Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpiA PE=3 SV=1 14 199 1.0E-12
sp|Q2A467|RPIA_FRATH Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpiA PE=3 SV=1 14 199 1.0E-12
sp|A7NBA0|RPIA_FRATF Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpiA PE=3 SV=1 14 199 1.0E-12
sp|Q14H27|RPIA_FRAT1 Ribose-5-phosphate isomerase A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpiA PE=3 SV=1 14 199 1.0E-12
sp|Q1JHB8|RPIA_STRPD Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpiA PE=3 SV=1 33 199 1.0E-12
sp|Q04BQ8|RPIA_LACDB Ribose-5-phosphate isomerase A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpiA PE=3 SV=1 33 168 2.0E-12
sp|Q1GBA8|RPIA_LACDA Ribose-5-phosphate isomerase A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpiA PE=3 SV=1 33 168 2.0E-12
sp|B5XL07|RPIA_STRPZ Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpiA PE=3 SV=1 10 199 2.0E-12
sp|A2RF13|RPIA_STRPG Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpiA PE=3 SV=1 10 199 2.0E-12
sp|Q1J737|RPIA_STRPF Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpiA PE=3 SV=1 10 199 2.0E-12
sp|Q1JM73|RPIA_STRPC Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpiA PE=3 SV=1 10 199 2.0E-12
sp|Q1JC89|RPIA_STRPB Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpiA PE=3 SV=1 10 199 2.0E-12
sp|Q5XCL6|RPIA_STRP6 Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpiA PE=3 SV=1 33 199 2.0E-12
sp|Q3SGD3|RPIA_THIDA Ribose-5-phosphate isomerase A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpiA PE=3 SV=1 14 199 2.0E-12
sp|Q2YBX7|RPIA_NITMU Ribose-5-phosphate isomerase A OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpiA PE=3 SV=1 27 199 2.0E-12
sp|B0T734|RPIA_CAUSK Ribose-5-phosphate isomerase A OS=Caulobacter sp. (strain K31) GN=rpiA PE=3 SV=1 26 201 2.0E-12
sp|A1USF7|RPIA_BARBK Ribose-5-phosphate isomerase A OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpiA PE=3 SV=1 14 279 4.0E-12
sp|B0TY81|RPIA_FRAP2 Ribose-5-phosphate isomerase A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpiA PE=3 SV=1 33 199 4.0E-12
sp|Q9A5Z4|RPIA_CAUCR Ribose-5-phosphate isomerase A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpiA PE=3 SV=1 26 245 7.0E-12
sp|B8GYT0|RPIA_CAUCN Ribose-5-phosphate isomerase A OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpiA PE=3 SV=1 26 245 7.0E-12
sp|Q97RI7|RPIA_STRPN Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpiA PE=3 SV=1 10 246 7.0E-12
sp|Q5WCM4|RPIA_BACSK Ribose-5-phosphate isomerase A OS=Bacillus clausii (strain KSM-K16) GN=rpiA PE=3 SV=1 15 245 8.0E-12
sp|A7MTQ9|RPIA_VIBCB Ribose-5-phosphate isomerase A OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpiA PE=3 SV=1 14 245 9.0E-12
sp|C1CS62|RPIA_STRZT Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpiA PE=3 SV=1 10 246 2.0E-11
sp|C1CJR7|RPIA_STRZP Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain P1031) GN=rpiA PE=3 SV=1 10 246 2.0E-11
sp|Q8DQD1|RPIA_STRR6 Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpiA PE=3 SV=2 10 246 2.0E-11
sp|C1C6G3|RPIA_STRP7 Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae (strain 70585) GN=rpiA PE=3 SV=1 10 246 2.0E-11
sp|B5E3K1|RPIA_STRP4 Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpiA PE=3 SV=1 10 246 2.0E-11
sp|Q04L82|RPIA_STRP2 Ribose-5-phosphate isomerase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpiA PE=3 SV=1 10 246 2.0E-11
sp|A5I9R2|RPIA_LEGPC Ribose-5-phosphate isomerase A OS=Legionella pneumophila (strain Corby) GN=rpiA PE=3 SV=1 33 245 3.0E-11
sp|Q8P1C5|RPIA_STRP8 Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpiA PE=3 SV=1 10 199 3.0E-11
sp|A8YU42|RPIA_LACH4 Ribose-5-phosphate isomerase A OS=Lactobacillus helveticus (strain DPC 4571) GN=rpiA PE=3 SV=1 11 172 3.0E-11
sp|Q48U18|RPIA_STRPM Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpiA PE=3 SV=1 33 199 3.0E-11
sp|Q3KME9|RPIA_CHLTA Ribose-5-phosphate isomerase A OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpiA PE=3 SV=1 6 203 3.0E-11
sp|B2JKP8|RPIA_BURP8 Ribose-5-phosphate isomerase A OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpiA PE=3 SV=1 20 259 3.0E-11
sp|B0BBJ3|RPIA_CHLTB Ribose-5-phosphate isomerase A OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpiA PE=3 SV=1 6 203 3.0E-11
sp|B0B9W3|RPIA_CHLT2 Ribose-5-phosphate isomerase A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpiA PE=3 SV=1 6 203 3.0E-11
sp|Q5X8Y4|RPIA_LEGPA Ribose-5-phosphate isomerase A OS=Legionella pneumophila (strain Paris) GN=rpiA PE=3 SV=1 33 245 3.0E-11
sp|B8GNF8|RPIA_THISH Ribose-5-phosphate isomerase A OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpiA PE=3 SV=1 32 245 3.0E-11
sp|Q5X0C7|RPIA_LEGPL Ribose-5-phosphate isomerase A OS=Legionella pneumophila (strain Lens) GN=rpiA PE=3 SV=1 33 245 4.0E-11
sp|Q5ZZB7|RPIA_LEGPH Ribose-5-phosphate isomerase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpiA PE=3 SV=1 33 235 4.0E-11
sp|Q5FLF6|RPIA_LACAC Ribose-5-phosphate isomerase A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpiA PE=3 SV=1 14 205 4.0E-11
sp|O84215|RPIA_CHLTR Ribose-5-phosphate isomerase A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpiA PE=3 SV=1 6 203 5.0E-11
sp|C0ME44|RPIA_STRS7 Ribose-5-phosphate isomerase A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpiA PE=3 SV=1 10 161 7.0E-11
sp|C0M7X6|RPIA_STRE4 Ribose-5-phosphate isomerase A OS=Streptococcus equi subsp. equi (strain 4047) GN=rpiA PE=3 SV=1 10 161 8.0E-11
sp|B4U3E7|RPIA_STREM Ribose-5-phosphate isomerase A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpiA PE=3 SV=1 10 161 8.0E-11
sp|P0DF27|RPIA_STRPQ Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpiA PE=3 SV=1 10 199 1.0E-10
sp|P0DF26|RPIA_STRP3 Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpiA PE=3 SV=1 10 199 1.0E-10
sp|P66697|RPIA_STRP1 Ribose-5-phosphate isomerase A OS=Streptococcus pyogenes serotype M1 GN=rpiA PE=3 SV=1 10 199 1.0E-10
sp|Q6MC00|RPIA_PARUW Ribose-5-phosphate isomerase A OS=Protochlamydia amoebophila (strain UWE25) GN=rpiA PE=3 SV=1 33 250 9.0E-10
sp|A3CNA9|RPIA_STRSV Ribose-5-phosphate isomerase A OS=Streptococcus sanguinis (strain SK36) GN=rpiA PE=3 SV=1 10 246 1.0E-09
sp|Q8DTT9|RPIA_STRMU Ribose-5-phosphate isomerase A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpiA PE=1 SV=1 10 172 1.0E-09
sp|B4E852|RPIA_BURCJ Ribose-5-phosphate isomerase A OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpiA PE=3 SV=1 20 245 2.0E-09
sp|A0K724|RPIA_BURCH Ribose-5-phosphate isomerase A OS=Burkholderia cenocepacia (strain HI2424) GN=rpiA PE=3 SV=1 20 245 2.0E-09
sp|B1K0R9|RPIA_BURCC Ribose-5-phosphate isomerase A OS=Burkholderia cenocepacia (strain MC0-3) GN=rpiA PE=3 SV=1 20 245 2.0E-09
sp|Q1BWM9|RPIA_BURCA Ribose-5-phosphate isomerase A OS=Burkholderia cenocepacia (strain AU 1054) GN=rpiA PE=3 SV=1 20 245 2.0E-09
sp|Q9Z942|RPIA_CHLPN Ribose-5-phosphate isomerase A OS=Chlamydia pneumoniae GN=rpiA PE=3 SV=1 8 204 1.0E-08
sp|Q9YEA9|RPIA_AERPE Ribose-5-phosphate isomerase A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpiA PE=3 SV=1 75 248 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009052 pentose-phosphate shunt, non-oxidative branch Yes
GO:0004751 ribose-5-phosphate isomerase activity Yes
GO:0016860 intramolecular oxidoreductase activity No
GO:0006091 generation of precursor metabolites and energy No
GO:1901135 carbohydrate derivative metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0016853 isomerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5468
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1783
Ophiocordyceps australis map64 (Brazil) OphauB2|5545
Ophiocordyceps camponoti-floridani Ophcf2|01803
Ophiocordyceps camponoti-rufipedis Ophun1|5940 (this protein)
Ophiocordyceps kimflemingae Ophio5|1512
Ophiocordyceps subramaniannii Hirsu2|6343

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5940
MSLITSSDLVETAKKAAAFQAVRDYLLPSFHFVGIGSGSTVQYVVDAIVEKGPAFYGNMVFVPTGRQSKGLIMNA
GLGLCNLDERPVINGKPVAIDVAFDGADEIDEDLNLIKGGGACLFQEKLVAISAKRFIAVADYRKQSARLCSTWK
TIPLEVLPIAAPLVLGRLKALGSANATVRSGLPGKAGECVTDNGMWIIDAPFPPLLLQRDVTAAVAGKGHDGVWE
VNTLAKELVSIPGIVEIGLFHGFDGDQGSQLGRELQAQKPVAAYFGMPDGQVQVQHAAGTSPAL*
Coding >Ophun1|5940
ATGTCTCTCATAACATCTTCGGATCTCGTTGAGACTGCGAAGAAGGCTGCAGCTTTCCAGGCGGTGCGGGATTAT
CTTCTCCCGTCATTCCATTTCGTTGGAATTGGATCTGGGTCAACCGTTCAGTACGTTGTTGATGCCATTGTGGAG
AAAGGACCTGCTTTCTACGGCAATATGGTTTTTGTTCCTACGGGGAGACAATCGAAAGGACTTATAATGAACGCT
GGGTTGGGTCTCTGCAACCTAGATGAACGCCCTGTCATTAATGGGAAACCGGTTGCAATAGATGTTGCATTTGAC
GGTGCCGATGAGATCGATGAGGATCTCAACTTGATTAAAGGGGGCGGCGCGTGCCTTTTCCAAGAGAAGCTGGTA
GCAATATCAGCCAAGAGATTCATAGCAGTTGCTGACTACCGCAAGCAGTCTGCAAGGCTCTGTTCGACGTGGAAG
ACTATACCACTCGAGGTCTTGCCTATTGCTGCACCCCTGGTGCTCGGTCGACTAAAAGCTCTGGGATCCGCCAAT
GCAACTGTTCGCTCAGGTCTTCCTGGGAAAGCTGGCGAATGCGTTACCGATAATGGCATGTGGATCATTGACGCG
CCTTTTCCTCCGCTACTTCTTCAGCGAGATGTGACCGCCGCAGTGGCTGGCAAAGGACATGATGGCGTATGGGAG
GTCAATACGCTTGCAAAAGAGCTCGTGAGCATTCCTGGTATCGTCGAAATTGGACTATTTCATGGCTTCGACGGG
GACCAGGGATCACAACTTGGAAGGGAATTGCAGGCACAGAAACCCGTTGCTGCATATTTTGGCATGCCTGACGGT
CAGGTCCAAGTACAGCATGCTGCCGGCACAAGCCCTGCTCTATAG
Transcript >Ophun1|5940
ATGTCTCTCATAACATCTTCGGATCTCGTTGAGACTGCGAAGAAGGCTGCAGCTTTCCAGGCGGTGCGGGATTAT
CTTCTCCCGTCATTCCATTTCGTTGGAATTGGATCTGGGTCAACCGTTCAGTACGTTGTTGATGCCATTGTGGAG
AAAGGACCTGCTTTCTACGGCAATATGGTTTTTGTTCCTACGGGGAGACAATCGAAAGGACTTATAATGAACGCT
GGGTTGGGTCTCTGCAACCTAGATGAACGCCCTGTCATTAATGGGAAACCGGTTGCAATAGATGTTGCATTTGAC
GGTGCCGATGAGATCGATGAGGATCTCAACTTGATTAAAGGGGGCGGCGCGTGCCTTTTCCAAGAGAAGCTGGTA
GCAATATCAGCCAAGAGATTCATAGCAGTTGCTGACTACCGCAAGCAGTCTGCAAGGCTCTGTTCGACGTGGAAG
ACTATACCACTCGAGGTCTTGCCTATTGCTGCACCCCTGGTGCTCGGTCGACTAAAAGCTCTGGGATCCGCCAAT
GCAACTGTTCGCTCAGGTCTTCCTGGGAAAGCTGGCGAATGCGTTACCGATAATGGCATGTGGATCATTGACGCG
CCTTTTCCTCCGCTACTTCTTCAGCGAGATGTGACCGCCGCAGTGGCTGGCAAAGGACATGATGGCGTATGGGAG
GTCAATACGCTTGCAAAAGAGCTCGTGAGCATTCCTGGTATCGTCGAAATTGGACTATTTCATGGCTTCGACGGG
GACCAGGGATCACAACTTGGAAGGGAATTGCAGGCACAGAAACCCGTTGCTGCATATTTTGGCATGCCTGACGGT
CAGGTCCAAGTACAGCATGCTGCCGGCACAAGCCCTGCTCTATAG
Gene >Ophun1|5940
ATGTCTCTCATAACATCTTCGGATCTCGTTGAGACTGCGAAGAAGGCTGCAGCTTTCCAGGCGGTGCGGGATTAT
CTTCTCCCGTCATTCCATTTCGTTGGAATTGGATCTGGGTCAACCGTTCAGTACGTTGTTGATGCCATTGTGGAG
AAAGGACCTGCTTTCTACGGCAATATGGTTTTTGTTCCTACGGGGAGACAATCGAAAGGACTTATAATGAACGCT
GGGTTGGGTCTCTGCAACCTAGATGAACGCCCTGTCATTAATGGGAAACCGGTTGCAATAGATGTTGCATTTGAC
GGTGCCGATGAGATCGATGAGGATCTCAACTTGATTAAAGGGGGCGGCGCGTGCCTTTTCCAAGAGAAGCTGGTA
GCAATATCAGCCAAGAGATTCATAGCAGTTGCTGGTGAGACAATCGAAGTTTGGCACGGGAATGGTTAATCGTGA
CACTCATGTATAGACTACCGCAAGCAGTCTGCAAGGCTCTGTTCGACGTGGAAGACTATACCACTCGAGGTCTTG
CCTATTGCTGCACCCCTGGTGCTCGGTCGACTAAAAGCTCTGGGATCCGCCAATGCAACTGTTCGCTCAGGTCTT
CCTGGGAAAGCTGGCGAATGCGTTACCGATAATGGCATGTGGATCATTGACGCGCCTTTTCCTCCGCTACTTCTT
CAGCGAGATGTGACCGCCGCAGTGGCTGGCAAAGGACATGATGGCGTATGGGAGGTCAATACGCTTGCAAAAGAG
CTCGTGAGCATTCCTGGTATCGTCGAAATTGGACTATTTCATGGCTTCGACGGGGACCAGGGATCACAACTTGGA
AGGGAATTGCAGGCACAGAAACCCGTTGCTGCATATTTTGGCATGCCTGACGGTCAGGTCCAAGTACAGCATGCT
GCCGGCACAAGCCCTGCTCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail