Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|594
Gene name
LocationContig_1189:1837..2869
Strand+
Gene length (bp)1032
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 3.7E-09 9 117

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6763
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06750
Ophiocordyceps camponoti-rufipedis Ophun1|594 (this protein)
Ophiocordyceps kimflemingae Ophio5|8069
Ophiocordyceps subramaniannii Hirsu2|8120

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|594
MKSRKPTTFHPFPRLPVELRRQIWQHAMPDVHAPAVYLYNWRWNLELVDPDMIRYRGFLQRARYVDIGPVPATPW
VSLEARETSVDFSKKHEIQVHINKTTMTSRAVRRWNKATDVLYVGIDQWDQFREWCCISQPHMMGAAQYVRHLAV
PYEVLQQGGGQDFSFDVLKYMDDLEKLSVVWGKQPELGTMANDAPEGLYRQDFWIDEDSMDEDDLDSDDELVMMD
GGGGYWEDYDEEMANVEWRDEEGAPVPAQDDDWETESESLRPLSDVQPRYKLVPMTGGNSSRATRFAQHVQALMD
DVKGDLEDNMGMMLVDWPVPGVLDVDTGKLKFTVEAVRAVRDV*
Coding >Ophun1|594
ATGAAGAGCAGGAAGCCCACGACCTTTCACCCCTTCCCGCGACTCCCCGTCGAGCTGCGACGGCAGATATGGCAG
CACGCCATGCCCGATGTCCACGCGCCGGCCGTCTATCTCTACAACTGGCGGTGGAACCTCGAGCTCGTGGACCCG
GACATGATACGATACCGGGGGTTTCTTCAGCGCGCGCGATACGTCGACATCGGTCCCGTGCCGGCCACGCCGTGG
GTCAGCCTCGAAGCCCGGGAGACGTCGGTCGATTTCTCCAAGAAGCACGAGATCCAAGTACACATCAACAAGACC
ACCATGACGAGCCGGGCGGTGCGGCGGTGGAACAAGGCTACCGATGTGCTGTACGTGGGCATCGACCAGTGGGAT
CAGTTTCGCGAGTGGTGCTGCATCAGCCAGCCTCACATGATGGGCGCCGCCCAGTACGTCCGTCATCTCGCCGTT
CCCTACGAGGTGCTCCAGCAAGGCGGCGGACAGGACTTCTCCTTCGACGTGCTCAAGTACATGGACGACCTGGAG
AAGCTGAGCGTGGTATGGGGCAAGCAGCCGGAGCTGGGAACCATGGCCAACGACGCGCCCGAGGGGTTATACCGC
CAGGATTTTTGGATAGATGAGGATAGCATGGATGAGGATGACCTCGACAGCGACGACGAGCTGGTTATGATGGAT
GGGGGAGGCGGCTATTGGGAAGACTACGACGAGGAGATGGCCAATGTCGAGTGGCGGGACGAGGAGGGCGCTCCG
GTGCCGGCGCAGGATGACGACTGGGAGACGGAGTCGGAGTCTCTCCGGCCGTTGAGCGACGTGCAGCCGCGATAC
AAGCTGGTGCCCATGACGGGCGGTAACTCGAGCCGGGCGACGCGATTCGCGCAACACGTGCAGGCGCTGATGGAT
GACGTCAAGGGCGATCTGGAGGATAACATGGGCATGATGCTGGTAGACTGGCCGGTCCCGGGCGTGCTGGATGTC
GATACGGGGAAGCTCAAGTTTACCGTCGAGGCGGTCAGGGCGGTGCGGGATGTGTGA
Transcript >Ophun1|594
ATGAAGAGCAGGAAGCCCACGACCTTTCACCCCTTCCCGCGACTCCCCGTCGAGCTGCGACGGCAGATATGGCAG
CACGCCATGCCCGATGTCCACGCGCCGGCCGTCTATCTCTACAACTGGCGGTGGAACCTCGAGCTCGTGGACCCG
GACATGATACGATACCGGGGGTTTCTTCAGCGCGCGCGATACGTCGACATCGGTCCCGTGCCGGCCACGCCGTGG
GTCAGCCTCGAAGCCCGGGAGACGTCGGTCGATTTCTCCAAGAAGCACGAGATCCAAGTACACATCAACAAGACC
ACCATGACGAGCCGGGCGGTGCGGCGGTGGAACAAGGCTACCGATGTGCTGTACGTGGGCATCGACCAGTGGGAT
CAGTTTCGCGAGTGGTGCTGCATCAGCCAGCCTCACATGATGGGCGCCGCCCAGTACGTCCGTCATCTCGCCGTT
CCCTACGAGGTGCTCCAGCAAGGCGGCGGACAGGACTTCTCCTTCGACGTGCTCAAGTACATGGACGACCTGGAG
AAGCTGAGCGTGGTATGGGGCAAGCAGCCGGAGCTGGGAACCATGGCCAACGACGCGCCCGAGGGGTTATACCGC
CAGGATTTTTGGATAGATGAGGATAGCATGGATGAGGATGACCTCGACAGCGACGACGAGCTGGTTATGATGGAT
GGGGGAGGCGGCTATTGGGAAGACTACGACGAGGAGATGGCCAATGTCGAGTGGCGGGACGAGGAGGGCGCTCCG
GTGCCGGCGCAGGATGACGACTGGGAGACGGAGTCGGAGTCTCTCCGGCCGTTGAGCGACGTGCAGCCGCGATAC
AAGCTGGTGCCCATGACGGGCGGTAACTCGAGCCGGGCGACGCGATTCGCGCAACACGTGCAGGCGCTGATGGAT
GACGTCAAGGGCGATCTGGAGGATAACATGGGCATGATGCTGGTAGACTGGCCGGTCCCGGGCGTGCTGGATGTC
GATACGGGGAAGCTCAAGTTTACCGTCGAGGCGGTCAGGGCGGTGCGGGATGTGTGA
Gene >Ophun1|594
ATGAAGAGCAGGAAGCCCACGACCTTTCACCCCTTCCCGCGACTCCCCGTCGAGCTGCGACGGCAGATATGGCAG
CACGCCATGCCCGATGTCCACGCGCCGGCCGTCTATCTCTACAACTGGCGGTGGAACCTCGAGCTCGTGGACCCG
GACATGATACGATACCGGGGGTTTCTTCAGCGCGCGCGATACGTCGACATCGGTCCCGTGCCGGCCACGCCGTGG
GTCAGCCTCGAAGCCCGGGAGACGTCGGTCGATTTCTCCAAGAAGCACGAGATCCAAGTACACATCAACAAGACC
ACCATGACGAGCCGGGCGGTGCGGCGGTGGAACAAGGCTACCGATGTGCTGTACGTGGGCATCGACCAGTGGGAT
CAGTTTCGCGAGTGGTGCTGCATCAGCCAGCCTCACATGATGGGCGCCGCCCAGTACGTCCGTCATCTCGCCGTT
CCCTACGAGGTGCTCCAGCAAGGCGGCGGACAGGACTTCTCCTTCGACGTGCTCAAGTACATGGACGACCTGGAG
AAGCTGAGCGTGGTATGGGGCAAGCAGCCGGAGCTGGGAACCATGGCCAACGACGCGCCCGAGGGGTTATACCGC
CAGGATTTTTGGATAGATGAGGATAGCATGGATGAGGATGACCTCGACAGCGACGACGAGCTGGTTATGATGGAT
GGGGGAGGCGGCTATTGGGAAGACTACGACGAGGAGATGGCCAATGTCGAGTGGCGGGACGAGGAGGGCGCTCCG
GTGCCGGCGCAGGATGACGACTGGGAGACGGAGTCGGAGTCTCTCCGGCCGTTGAGCGACGTGCAGCCGCGATAC
AAGCTGGTGCCCATGACGGGCGGTAACTCGAGCCGGGCGACGCGATTCGCGCAACACGTGCAGGCGCTGATGGAT
GACGTCAAGGGCGATCTGGAGGATAACATGGGCATGATGCTGGTAGACTGGCCGGTCCCGGGCGTGCTGGATGTC
GATACGGGGAAGCTCAAGTTTACCGTCGAGGCGGTCAGGGCGGTGCGGGATGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail