Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5935
Gene name
LocationContig_612:4092..5629
Strand-
Gene length (bp)1537
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 2.1E-12 171 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 53 389 3.0E-17
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 406 1.0E-13
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 138 406 1.0E-13
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 1 373 4.0E-13
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 63 389 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 53 389 3.0E-17
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 406 1.0E-13
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 138 406 1.0E-13
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 1 373 4.0E-13
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 63 389 2.0E-11
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 1 366 2.0E-10
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 1 366 5.0E-10
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 2 403 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5935
MKIVIVGAGISGCGIYLLLKKHLPKPLSAEPHDITIYEAYDTDKDTTASARGQGPTHSSTLVVGGGLGVGANGLN
VLKRLDEDILRDVVSGGYVVPTMKMKTKGGTVLARVQPCGNGDGKSDNGMNMVASSRHWLWRCLRTRVPDDAIVT
KTVTQVVANGEGRNIVQFADGTTVEADMVIGADGLKSLTKNALFPEAESGPFPPIYEGLVGVGGFIPSSEVRHLV
EKGTMNCVFGGNGFFGYFFADSAKSDPNRESPFHVSEPGESLGWWSTYSAEQCPTPETLDPEAVTRQLRERHGSW
KDPVVQKVLETVQIKSMYPTWTVPPLPTWERNGVVLVGDAAHALPPTSGQGSSQSLEDAEALTLFLCHHLRRAYR
EHRTDVASRKELISMAAKQYMELRLPRVTKMLHEAQSMQSSKRNMTVVQEYAMYLIMWIMGYFPSLMAKPLKAVI
EYNVAEEVKKILGKTD*
Coding >Ophun1|5935
ATGAAGATCGTCATCGTCGGAGCGGGCATCTCCGGGTGCGGCATTTATCTGCTGCTGAAGAAGCACTTGCCCAAG
CCCCTGTCGGCAGAGCCGCACGACATCACCATCTACGAAGCCTACGACACGGACAAGGACACGACTGCGTCGGCT
CGCGGCCAGGGTCCAACCCATTCGTCGACGCTCGTGGTCGGCGGTGGCCTGGGCGTGGGCGCCAATGGGCTCAAC
GTACTGAAGCGCCTCGACGAGGATATCCTCCGCGACGTCGTCAGCGGCGGATATGTCGTGCCGACGATGAAGATG
AAGACCAAGGGGGGTACGGTACTCGCTCGGGTGCAGCCGTGCGGAAACGGGGACGGCAAGTCGGACAACGGCATG
AACATGGTTGCCAGCAGTCGTCACTGGCTCTGGAGATGCCTTCGCACCCGAGTACCGGACGACGCCATCGTGACT
AAAACGGTGACCCAGGTGGTGGCCAACGGCGAGGGTCGCAACATCGTCCAGTTTGCCGATGGGACCACGGTCGAG
GCCGACATGGTCATTGGCGCCGACGGCCTCAAGAGTCTAACCAAGAATGCCTTGTTTCCAGAGGCAGAAAGCGGT
CCGTTTCCGCCCATCTACGAAGGTCTGGTCGGCGTTGGTGGCTTCATCCCCTCGAGCGAGGTGAGGCATCTGGTA
GAAAAGGGTACGATGAACTGTGTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTCGCCGACAGCGCAAAGTCG
GACCCGAATCGCGAGTCGCCCTTTCACGTGTCGGAGCCCGGTGAAAGCCTCGGCTGGTGGTCGACGTACTCGGCC
GAGCAGTGTCCGACGCCGGAGACGCTCGACCCGGAAGCCGTAACCCGACAGCTGCGGGAGCGGCACGGGAGTTGG
AAGGACCCCGTGGTGCAAAAGGTGCTGGAGACGGTGCAGATCAAGAGCATGTATCCGACATGGACGGTGCCGCCG
TTGCCGACGTGGGAGCGCAACGGCGTCGTCCTCGTTGGCGACGCGGCCCATGCCTTGCCCCCGACGTCGGGCCAG
GGGTCGTCGCAGTCGCTCGAGGACGCCGAGGCGCTGACCCTCTTCCTCTGCCACCATCTGCGCAGGGCGTACCGG
GAACACAGAACCGACGTTGCCAGCCGCAAGGAACTCATCAGCATGGCAGCGAAGCAGTACATGGAGCTGCGGCTG
CCCCGCGTTACCAAGATGCTGCATGAGGCTCAGTCGATGCAGAGCTCGAAGCGGAACATGACGGTGGTGCAGGAA
TATGCCATGTACTTGATCATGTGGATCATGGGTTACTTTCCCAGCCTCATGGCTAAGCCGTTGAAAGCGGTGATT
GAGTATAACGTGGCGGAGGAGGTCAAGAAGATTCTAGGCAAGACGGACTGA
Transcript >Ophun1|5935
ATGAAGATCGTCATCGTCGGAGCGGGCATCTCCGGGTGCGGCATTTATCTGCTGCTGAAGAAGCACTTGCCCAAG
CCCCTGTCGGCAGAGCCGCACGACATCACCATCTACGAAGCCTACGACACGGACAAGGACACGACTGCGTCGGCT
CGCGGCCAGGGTCCAACCCATTCGTCGACGCTCGTGGTCGGCGGTGGCCTGGGCGTGGGCGCCAATGGGCTCAAC
GTACTGAAGCGCCTCGACGAGGATATCCTCCGCGACGTCGTCAGCGGCGGATATGTCGTGCCGACGATGAAGATG
AAGACCAAGGGGGGTACGGTACTCGCTCGGGTGCAGCCGTGCGGAAACGGGGACGGCAAGTCGGACAACGGCATG
AACATGGTTGCCAGCAGTCGTCACTGGCTCTGGAGATGCCTTCGCACCCGAGTACCGGACGACGCCATCGTGACT
AAAACGGTGACCCAGGTGGTGGCCAACGGCGAGGGTCGCAACATCGTCCAGTTTGCCGATGGGACCACGGTCGAG
GCCGACATGGTCATTGGCGCCGACGGCCTCAAGAGTCTAACCAAGAATGCCTTGTTTCCAGAGGCAGAAAGCGGT
CCGTTTCCGCCCATCTACGAAGGTCTGGTCGGCGTTGGTGGCTTCATCCCCTCGAGCGAGGTGAGGCATCTGGTA
GAAAAGGGTACGATGAACTGTGTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTCGCCGACAGCGCAAAGTCG
GACCCGAATCGCGAGTCGCCCTTTCACGTGTCGGAGCCCGGTGAAAGCCTCGGCTGGTGGTCGACGTACTCGGCC
GAGCAGTGTCCGACGCCGGAGACGCTCGACCCGGAAGCCGTAACCCGACAGCTGCGGGAGCGGCACGGGAGTTGG
AAGGACCCCGTGGTGCAAAAGGTGCTGGAGACGGTGCAGATCAAGAGCATGTATCCGACATGGACGGTGCCGCCG
TTGCCGACGTGGGAGCGCAACGGCGTCGTCCTCGTTGGCGACGCGGCCCATGCCTTGCCCCCGACGTCGGGCCAG
GGGTCGTCGCAGTCGCTCGAGGACGCCGAGGCGCTGACCCTCTTCCTCTGCCACCATCTGCGCAGGGCGTACCGG
GAACACAGAACCGACGTTGCCAGCCGCAAGGAACTCATCAGCATGGCAGCGAAGCAGTACATGGAGCTGCGGCTG
CCCCGCGTTACCAAGATGCTGCATGAGGCTCAGTCGATGCAGAGCTCGAAGCGGAACATGACGGTGGTGCAGGAA
TATGCCATGTACTTGATCATGTGGATCATGGGTTACTTTCCCAGCCTCATGGCTAAGCCGTTGAAAGCGGTGATT
GAGTATAACGTGGCGGAGGAGGTCAAGAAGATTCTAGGCAAGACGGACTGA
Gene >Ophun1|5935
ATGAAGATCGTCATCGTCGGAGCGGGCATCTCCGGGTGCGGCATTTATCTGCTGCTGAAGAAGCACTTGCCCAAG
CCCCTGTCGGCAGAGCCGCACGACATCACCATCTACGAAGCCTACGACACGGACAAGGACACGACTGCGTCGGCT
CGCGGCCAGGGTCCAACCCATTCGTCGACGCTCGTGGTCGGCGGTGGCCTGGGCGTGGGCGCCAATGGGCTCAAC
GTACTGAAGCGCCTCGACGAGGATATCCTCCGCGACGTCGTCAGCGGCGGATATGTCGTGCCGACGATGAAGATG
AAGACCAAGGGGGGTACGGTACTCGCTCGGGTGCAGCCGTGCGGAAACGGGGACGGCAAGTCGGACAACGGCATG
AACATGGTTGCCAGCAGTCGTCACTGGCTCTGGAGATGCCTTCGCACCCGAGTACCGGACGACGCCATCGTGACT
AAAACGGTGACCCAGGTGGTGGCCAACGGCGAGGGTCGCAACATCGTCCAGTTTGCCGATGGGACCACGGTCGAG
GCCGACATGGTCATTGGCGCCGACGGCCTCAAGAGTCTAACCAAGAATGCCTTGTTTCCAGAGGCAGAAAGCGGT
CCGTTTCCGCCCATCTACGAGTGAGCGCGCGTTGTCATCGTCGTAGACGCGCAGGACGCCGAGGCTGACGCTTCG
GATGCAGAGGTCTGGTCGGCGTTGGTGGCTTCATCCCCTCGAGCGAGGTGAGGCATCTGGTAGAAAAGGGTACGA
TGAACTGTGTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTCGCCGACAGCGCAAAGTCGGACCCGAATCGCG
AGTCGCCCTTTCACGTGTCGGAGCCCGGTGAAAGCCTCGGCTGGTGGTCGACGTACTCGGCCGAGCAGTGTCCGA
CGCCGGAGACGCTCGACCCGGAAGCCGTAACCCGACAGCTGCGGGAGCGGCACGGGAGTTGGAAGGACCCCGTGG
TGCAAAAGGTGCTGGAGACGGTGCAGATCAAGAGCATGTATCCGACATGGACGGTGCCGCCGTTGCCGACGTGGG
AGCGCAACGGCGTCGTCCTCGTTGGCGACGCGGCCCATGCCTTGCCCCCGACGTCGGGCCAGGGGTCGTCGCAGT
CGCTCGAGGACGCCGAGGCGCTGACCCTCTTCCTCTGCCACCATCTGCGCAGGGCGTACCGGGAACACAGAACCG
ACGTTGCCAGCCGCAAGGAACTCATCAGCATGGCAGCGAAGCAGTACATGGAGCTGCGGCTGCCCCGCGTTACCA
AGATGCTGCATGAGGCTCAGTCGATGCAGAGCTCGAAGCGGAACATGACGGTGGTGCAGGAATATGCCATGTACT
TGATCATGTGGATCATGGGTACGTTCGTAGGCTTTCCAGGAACAATAACCGTCGCAACGAGGCAGAGCGAGGACG
TGGCTGATCCAGCACAGGTTACTTTCCCAGCCTCATGGCTAAGCCGTTGAAAGCGGTGATTGAGTATAACGTGGC
GGAGGAGGTCAAGAAGATTCTAGGCAAGACGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail