Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5933
Gene name
LocationContig_612:122..559
Strand-
Gene length (bp)437
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 2.6E-14 11 88

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74469|YQC7_SCHPO Exosome complex protein C1739.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.07 PE=1 SV=1 11 104 3.0E-15
sp|Q5XJ97|C1D_DANRE Nuclear nucleic acid-binding protein C1D OS=Danio rerio GN=c1d PE=2 SV=1 10 116 1.0E-08
sp|Q5ZHS3|C1D_CHICK Nuclear nucleic acid-binding protein C1D OS=Gallus gallus GN=C1D PE=2 SV=1 11 123 4.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2521
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3998
Ophiocordyceps australis map64 (Brazil) OphauB2|7462
Ophiocordyceps camponoti-floridani Ophcf2|06246
Ophiocordyceps camponoti-rufipedis Ophun1|5933 (this protein)
Ophiocordyceps kimflemingae Ophio5|3268
Ophiocordyceps subramaniannii Hirsu2|3686

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5933
MADVKNLAPDLERLDGQLDDLEEVLSPLLEGLDERAGRLPLLDRAKLFSLSAYAIESLLFSSLRLQGVDARNHAV
FTELKRVQQYFGKIQDAEGSKQRPTLTVNQEATARILKAGLVRFPPPQLM*
Coding >Ophun1|5933
ATGGCAGACGTCAAAAACCTAGCGCCGGACCTAGAACGACTAGACGGACAACTCGACGATCTAGAAGAGGTTCTA
TCGCCGCTGCTGGAGGGACTGGACGAGAGGGCTGGACGGCTCCCGCTTCTTGACAGGGCGAAGCTATTTTCTCTC
TCTGCGTATGCGATTGAGTCGTTGCTTTTCTCTTCGTTGCGGTTGCAGGGCGTTGACGCGAGGAATCATGCCGTC
TTTACGGAATTGAAGCGCGTGCAGCAGTATTTCGGGAAGATTCAGGATGCCGAGGGGAGTAAGCAACGGCCTACG
CTTACCGTTAACCAGGAGGCTACGGCGCGGATCCTCAAGGCGGGACTGGTGAGATTCCCCCCTCCCCAACTTATG
TGA
Transcript >Ophun1|5933
ATGGCAGACGTCAAAAACCTAGCGCCGGACCTAGAACGACTAGACGGACAACTCGACGATCTAGAAGAGGTTCTA
TCGCCGCTGCTGGAGGGACTGGACGAGAGGGCTGGACGGCTCCCGCTTCTTGACAGGGCGAAGCTATTTTCTCTC
TCTGCGTATGCGATTGAGTCGTTGCTTTTCTCTTCGTTGCGGTTGCAGGGCGTTGACGCGAGGAATCATGCCGTC
TTTACGGAATTGAAGCGCGTGCAGCAGTATTTCGGGAAGATTCAGGATGCCGAGGGGAGTAAGCAACGGCCTACG
CTTACCGTTAACCAGGAGGCTACGGCGCGGATCCTCAAGGCGGGACTGGTGAGATTCCCCCCTCCCCAACTTATG
TGA
Gene >Ophun1|5933
ATGGCAGACGTCAAAAACCTAGCGCCGGACCTAGAACGACTAGACGGACAACTCGACGATCTAGAAGAGGTTCTA
TCGCCGCTGCTGGAGGGACTGGACGAGAGGGCTGGACGGCTCCCGCTTCTTGACAGGGCGAAGCTATTTTCTCTC
TCTGCGTATGCGATTGAGTCGTTGCTTTTCTGTGAGTTTTTTTCTCTTTCTCCGTGTGTGGATTCCGACGGGGCT
GATTGGGGGGTGTAGCTTCGTTGCGGTTGCAGGGCGTTGACGCGAGGAATCATGCCGTCTTTACGGAATTGAAGC
GCGTGCAGCAGTATTTCGGGAAGATTCAGGATGCCGAGGGGAGTAAGCAACGGCCTACGCTTACCGTTAACCAGG
AGGCTACGGCGCGGATCCTCAAGGCGGGACTGGTGAGATTCCCCCCTCCCCAACTTATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail