Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5931
Gene name
LocationContig_611:9242..10271
Strand+
Gene length (bp)1029
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 9.4E-18 40 315
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.2E-13 41 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 40 331 8.0E-40
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 40 331 8.0E-39
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 40 331 1.0E-38
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 40 330 4.0E-38
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 41 339 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 40 331 8.0E-40
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 40 331 8.0E-39
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 40 331 1.0E-38
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 40 330 4.0E-38
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 41 339 1.0E-20
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 41 339 3.0E-20
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 41 332 7.0E-20
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 33 332 7.0E-18
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 27 331 1.0E-16
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 41 334 1.0E-15
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 41 331 5.0E-15
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 41 210 5.0E-11
sp|O52866|HYES_CORS2 Soluble epoxide hydrolase OS=Corynebacterium sp. (strain C12) PE=1 SV=3 41 137 4.0E-07
sp|Q1JU72|DEHA_BURSP Fluoroacetate dehalogenase OS=Burkholderia sp. GN=fac-dex PE=1 SV=1 40 283 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup680
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4296
Ophiocordyceps australis map64 (Brazil) OphauB2|5195
Ophiocordyceps camponoti-floridani Ophcf2|06542
Ophiocordyceps camponoti-rufipedis Ophun1|5931 (this protein)
Ophiocordyceps kimflemingae Ophio5|3209
Ophiocordyceps subramaniannii Hirsu2|11072

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5931
MQTDKLLPNDPRVRREKATVRGKTYSYILGEPSDKQPVDTIFLFHGFPDLGYGWRYQVPFLMKLGLRVVVPDMLG
YAGTDCPSDLRQFSRKSISDDVKELASLLVGDRPIILGGHDWGGVLVWRIAMWHPKLVKAVFSVCSPFMSIPRTH
YVSLEERFANGALTNFGYQLQFKGPDVEEAVQGREKLRLFFSASFGGRDGNGDPGFTPSEGFLLHRLPDIGNPPL
LPEEELDYYVEQYMLQDAPQLRGPLSWYRVAEIDFEEELPLADHKPVFQMPTLFIAASRDIALPPSMSAGMEEYM
PNLTRKEVQATHWALTEMPDAVNGHVGEWLNRVLKLETRSLL*
Coding >Ophun1|5931
ATGCAGACCGACAAGCTTCTCCCCAACGACCCGCGTGTACGACGCGAAAAGGCCACGGTCCGCGGCAAGACGTAC
AGCTACATCTTGGGCGAACCCTCCGACAAGCAGCCCGTCGATACCATCTTCCTCTTCCATGGCTTCCCGGACCTG
GGCTACGGTTGGCGCTACCAAGTGCCCTTTCTCATGAAGCTCGGGCTTCGCGTCGTCGTGCCAGACATGCTGGGT
TACGCCGGCACCGACTGTCCCAGTGACCTGCGCCAGTTCTCGCGCAAGTCCATCTCCGACGATGTCAAGGAGTTG
GCCAGCCTCTTGGTGGGTGACCGGCCCATCATCCTCGGTGGACACGACTGGGGTGGCGTCTTGGTCTGGCGCATC
GCCATGTGGCACCCCAAGCTGGTCAAGGCCGTCTTCAGCGTCTGCTCGCCCTTTATGTCCATCCCGCGCACCCAT
TACGTATCCCTAGAAGAGCGCTTTGCCAACGGCGCCTTGACCAACTTCGGGTATCAGCTGCAGTTCAAGGGTCCC
GACGTCGAGGAAGCCGTCCAGGGCAGGGAAAAGCTGCGCCTGTTCTTCAGCGCCTCATTCGGAGGTCGCGACGGC
AATGGCGATCCAGGCTTCACTCCCAGCGAGGGCTTCTTGCTTCACAGGCTACCGGATATTGGCAACCCGCCGCTG
CTGCCGGAAGAAGAGCTCGACTACTACGTCGAACAGTACATGCTCCAGGACGCTCCGCAGCTGCGCGGGCCGCTC
AGCTGGTATCGCGTGGCCGAGATTGACTTTGAAGAGGAGCTGCCCTTGGCGGACCACAAGCCCGTCTTCCAGATG
CCAACGCTCTTCATCGCCGCGTCCAGAGACATTGCCCTGCCGCCATCCATGTCCGCCGGCATGGAAGAGTACATG
CCCAACCTGACGCGGAAAGAGGTCCAGGCCACGCACTGGGCGCTCACGGAGATGCCTGACGCCGTCAACGGACAC
GTGGGCGAGTGGTTGAATCGAGTCCTCAAACTAGAGACTCGATCGCTCTTGTAA
Transcript >Ophun1|5931
ATGCAGACCGACAAGCTTCTCCCCAACGACCCGCGTGTACGACGCGAAAAGGCCACGGTCCGCGGCAAGACGTAC
AGCTACATCTTGGGCGAACCCTCCGACAAGCAGCCCGTCGATACCATCTTCCTCTTCCATGGCTTCCCGGACCTG
GGCTACGGTTGGCGCTACCAAGTGCCCTTTCTCATGAAGCTCGGGCTTCGCGTCGTCGTGCCAGACATGCTGGGT
TACGCCGGCACCGACTGTCCCAGTGACCTGCGCCAGTTCTCGCGCAAGTCCATCTCCGACGATGTCAAGGAGTTG
GCCAGCCTCTTGGTGGGTGACCGGCCCATCATCCTCGGTGGACACGACTGGGGTGGCGTCTTGGTCTGGCGCATC
GCCATGTGGCACCCCAAGCTGGTCAAGGCCGTCTTCAGCGTCTGCTCGCCCTTTATGTCCATCCCGCGCACCCAT
TACGTATCCCTAGAAGAGCGCTTTGCCAACGGCGCCTTGACCAACTTCGGGTATCAGCTGCAGTTCAAGGGTCCC
GACGTCGAGGAAGCCGTCCAGGGCAGGGAAAAGCTGCGCCTGTTCTTCAGCGCCTCATTCGGAGGTCGCGACGGC
AATGGCGATCCAGGCTTCACTCCCAGCGAGGGCTTCTTGCTTCACAGGCTACCGGATATTGGCAACCCGCCGCTG
CTGCCGGAAGAAGAGCTCGACTACTACGTCGAACAGTACATGCTCCAGGACGCTCCGCAGCTGCGCGGGCCGCTC
AGCTGGTATCGCGTGGCCGAGATTGACTTTGAAGAGGAGCTGCCCTTGGCGGACCACAAGCCCGTCTTCCAGATG
CCAACGCTCTTCATCGCCGCGTCCAGAGACATTGCCCTGCCGCCATCCATGTCCGCCGGCATGGAAGAGTACATG
CCCAACCTGACGCGGAAAGAGGTCCAGGCCACGCACTGGGCGCTCACGGAGATGCCTGACGCCGTCAACGGACAC
GTGGGCGAGTGGTTGAATCGAGTCCTCAAACTAGAGACTCGATCGCTCTTGTAA
Gene >Ophun1|5931
ATGCAGACCGACAAGCTTCTCCCCAACGACCCGCGTGTACGACGCGAAAAGGCCACGGTCCGCGGCAAGACGTAC
AGCTACATCTTGGGCGAACCCTCCGACAAGCAGCCCGTCGATACCATCTTCCTCTTCCATGGCTTCCCGGACCTG
GGCTACGGTTGGCGCTACCAAGTGCCCTTTCTCATGAAGCTCGGGCTTCGCGTCGTCGTGCCAGACATGCTGGGT
TACGCCGGCACCGACTGTCCCAGTGACCTGCGCCAGTTCTCGCGCAAGTCCATCTCCGACGATGTCAAGGAGTTG
GCCAGCCTCTTGGTGGGTGACCGGCCCATCATCCTCGGTGGACACGACTGGGGTGGCGTCTTGGTCTGGCGCATC
GCCATGTGGCACCCCAAGCTGGTCAAGGCCGTCTTCAGCGTCTGCTCGCCCTTTATGTCCATCCCGCGCACCCAT
TACGTATCCCTAGAAGAGCGCTTTGCCAACGGCGCCTTGACCAACTTCGGGTATCAGCTGCAGTTCAAGGGTCCC
GACGTCGAGGAAGCCGTCCAGGGCAGGGAAAAGCTGCGCCTGTTCTTCAGCGCCTCATTCGGAGGTCGCGACGGC
AATGGCGATCCAGGCTTCACTCCCAGCGAGGGCTTCTTGCTTCACAGGCTACCGGATATTGGCAACCCGCCGCTG
CTGCCGGAAGAAGAGCTCGACTACTACGTCGAACAGTACATGCTCCAGGACGCTCCGCAGCTGCGCGGGCCGCTC
AGCTGGTATCGCGTGGCCGAGATTGACTTTGAAGAGGAGCTGCCCTTGGCGGACCACAAGCCCGTCTTCCAGATG
CCAACGCTCTTCATCGCCGCGTCCAGAGACATTGCCCTGCCGCCATCCATGTCCGCCGGCATGGAAGAGTACATG
CCCAACCTGACGCGGAAAGAGGTCCAGGCCACGCACTGGGCGCTCACGGAGATGCCTGACGCCGTCAACGGACAC
GTGGGCGAGTGGTTGAATCGAGTCCTCAAACTAGAGACTCGATCGCTCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail