Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5928
Gene name
LocationContig_611:3282..6855
Strand+
Gene length (bp)3573
Transcript length (bp)2808
Coding sequence length (bp)2808
Protein length (aa) 936

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12330 Haspin_kinase Haspin like kinase domain 3.1E-29 109 432

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13924|HASP_SCHPO Serine/threonine-protein kinase haspin homolog hrk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrk1 PE=1 SV=1 76 429 2.0E-20
sp|Q9Z0R0|HASP_MOUSE Serine/threonine-protein kinase haspin OS=Mus musculus GN=Gsg2 PE=1 SV=3 108 445 8.0E-15
sp|Q2KIP2|HASP_BOVIN Serine/threonine-protein kinase haspin OS=Bos taurus GN=GSG2 PE=2 SV=1 108 437 8.0E-14
sp|Q8TF76|HASP_HUMAN Serine/threonine-protein kinase haspin OS=Homo sapiens GN=GSG2 PE=1 SV=3 108 437 3.0E-12
sp|P83103|HASP_DROME Putative serine/threonine-protein kinase haspin homolog OS=Drosophila melanogaster GN=Haspin PE=2 SV=1 108 405 6.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 886 908 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5928
MPAATTARKYGKSSKRSKAERLFAELPQSPVRVDPLSCLAGKLDALHIQSDAGKRRVERQPPSPRRKQPPPPPPP
SSSPRNESTSPLQGSLRVLTWEDVCPAGDDIVKIAEASYAEVYRVSNARGTSIIKAIRLDSPIKRQTKAQVRAGL
VDEEPHAEADVDGELQVSEWLADVPGFVVYKEKYLVRGKATGRLLETHRAFQQRMKRQDPGRAQFYPSPSRYLED
TSFLVVELGDAGTALEDWHVEDESQLWDIFLLEAVALARAENLAKFEHRDLHEGNICVRRVSSPRKRDGDDGFFG
YSGLEMTILDYGLSRAQDPADDEAKPVAFDLERDLGLFSSTHASQCVVYRRMRSYLLRRDRKCIPADGHKTPYAK
GVDGPLSWDVYAPYTNVLWLAYLYRYLADSFGGNKRDLARFKRETKEMWRHLDPDAADEVLCFGSAADVVGFAVE
AGWIRQDQLIGTGASLPDKEDSIILAHPQAHPQAHRPAMAVSGHDATLDDSFPRDLLSSSLSSSLSAYSVGSSAA
SSTAARRSSQMSKTYRQASTLFLTRRLPEALTTLTPLIVSPEKDEPAPVARASRTTRIKVWSLYLTILHAVVEME
PDDGKEAFGNQQWRALCLKVRDGLIWEEVVRDGYHGVEGDVDSDVVINLATLLLAHARDQTLNQRRLETYLATSN
TPNLDLTVRPDKSPVPRSHAGPRHRSPAPGTTGAETPRDLNARVKILELYTLHVLLRNNEWDYAREFISVSSVLD
DERREAFLQALESLQEEQQEQERQERAERHRQEEQLRRQIDDARRLRAENEEWERKRLEDEARRTRRPSTEVDYG
VEASPTPGRRHQRISSRMAASSSVGGKAVAPRTFTARASMILSRLRAVLDGLAASLNGNPALLARLLAFIVGLLI
LVGHGGIRRQIQRVLAASWTKFKTTAGMGTKISYI*
Coding >Ophun1|5928
ATGCCAGCAGCAACAACCGCCCGCAAGTACGGAAAATCATCGAAGCGGTCCAAGGCCGAGCGCCTCTTCGCCGAG
CTGCCTCAAAGCCCCGTGCGCGTCGACCCGTTATCTTGTCTCGCCGGGAAACTCGACGCGCTCCACATCCAAAGC
GACGCCGGGAAGAGGAGGGTAGAGCGACAGCCGCCTTCTCCGCGGAGGAAACAACCACCACCACCACCACCACCG
TCATCATCGCCGCGCAATGAGTCTACCTCTCCGCTTCAGGGCTCTCTCCGGGTCCTCACGTGGGAAGACGTCTGT
CCTGCCGGCGACGACATTGTCAAGATTGCAGAGGCTTCGTATGCAGAGGTCTATCGCGTCAGCAACGCGCGTGGC
ACGAGCATCATAAAGGCCATCCGCCTCGACTCGCCCATCAAGCGACAGACAAAAGCACAGGTGCGAGCGGGCCTC
GTAGACGAGGAACCGCATGCAGAAGCCGATGTCGATGGCGAGTTGCAGGTTTCCGAATGGTTGGCCGACGTGCCT
GGCTTCGTCGTCTACAAGGAGAAATACTTGGTTCGCGGCAAGGCCACCGGCAGGCTGCTCGAGACTCACCGGGCC
TTTCAGCAGAGAATGAAGAGGCAGGATCCGGGGCGGGCGCAGTTCTACCCGTCGCCGAGCCGATATCTCGAAGAT
ACCAGCTTTCTCGTCGTCGAGCTGGGTGACGCTGGCACCGCCTTGGAGGATTGGCACGTTGAGGACGAGAGCCAG
CTGTGGGACATCTTCCTCCTCGAGGCCGTAGCGCTGGCGAGAGCCGAGAATCTCGCCAAGTTCGAGCATCGCGAC
TTGCACGAGGGCAACATTTGCGTCAGACGTGTGAGCTCTCCGCGAAAGCGAGACGGCGACGACGGCTTCTTCGGC
TACTCCGGGCTCGAAATGACCATCCTCGACTACGGCCTCTCGCGCGCTCAAGACCCGGCAGACGACGAGGCCAAG
CCGGTAGCCTTTGACCTGGAAAGGGATCTCGGCCTCTTCAGCAGTACGCACGCGTCGCAGTGCGTCGTCTACCGC
CGGATGCGATCGTATCTCCTGCGCCGAGATCGCAAATGCATCCCAGCCGACGGACACAAGACGCCATACGCAAAG
GGAGTCGACGGGCCGCTGTCATGGGACGTATACGCGCCCTACACCAACGTGCTGTGGCTGGCCTACCTCTACCGC
TATCTCGCCGATAGCTTCGGTGGAAACAAGAGGGACCTGGCGCGCTTCAAGAGGGAGACGAAAGAGATGTGGCGG
CACCTGGATCCCGACGCAGCCGACGAGGTGTTGTGCTTTGGGTCGGCTGCTGACGTCGTCGGATTCGCCGTCGAG
GCGGGATGGATCCGGCAGGATCAACTGATCGGGACAGGGGCCTCGTTGCCGGACAAGGAGGATAGTATCATCTTG
GCTCATCCACAGGCTCATCCTCAGGCCCATCGACCAGCCATGGCCGTCTCCGGTCACGATGCCACGCTCGACGAC
TCCTTTCCGCGCGACCTGCTCTCTTCCTCTCTCTCGTCCTCCCTCTCCGCCTATTCCGTCGGCTCCTCGGCCGCC
TCGTCTACGGCCGCCCGTCGATCGTCGCAAATGTCAAAGACGTATCGCCAGGCTTCGACGCTCTTCCTGACCCGT
CGCCTGCCCGAGGCCCTGACGACGCTGACGCCCCTCATCGTCTCGCCCGAAAAGGATGAGCCGGCGCCCGTGGCA
AGGGCCTCCCGCACCACACGCATCAAGGTATGGAGCCTGTACCTGACCATCCTCCATGCCGTCGTCGAGATGGAA
CCCGACGACGGCAAGGAGGCCTTTGGCAACCAACAATGGAGGGCTCTGTGCCTCAAGGTCCGGGACGGCCTCATC
TGGGAGGAGGTGGTGAGGGATGGCTACCACGGCGTCGAGGGAGACGTCGACTCCGATGTCGTCATCAACCTGGCG
ACACTTCTCCTGGCGCACGCGCGCGATCAGACCTTGAATCAGCGCAGGCTCGAGACGTATCTGGCCACCTCCAAC
ACGCCGAACCTCGACCTGACAGTCCGTCCGGATAAGTCGCCCGTGCCGCGATCGCATGCCGGACCGCGACATCGG
TCTCCCGCTCCCGGCACGACCGGCGCCGAAACGCCGCGGGATCTCAACGCCCGCGTCAAGATACTGGAGCTGTAC
ACACTACACGTACTGCTGCGCAACAACGAGTGGGACTACGCCCGCGAGTTCATCAGCGTCAGTTCCGTCCTCGAC
GACGAGCGGCGCGAGGCCTTTCTCCAGGCCCTCGAGAGCCTGCAAGAGGAGCAGCAGGAACAGGAGCGGCAGGAG
AGGGCGGAGCGTCATCGCCAGGAGGAGCAGTTGCGTCGCCAGATCGACGATGCCAGACGGCTACGCGCCGAAAAT
GAAGAGTGGGAGAGGAAGCGGCTGGAAGACGAGGCGCGCCGGACGCGCCGCCCCAGCACCGAGGTCGATTATGGT
GTCGAGGCCAGTCCGACACCTGGTAGGCGGCATCAACGGATCTCGTCGCGCATGGCGGCCTCGTCGTCGGTCGGC
GGAAAGGCTGTCGCGCCCCGGACCTTTACGGCGCGGGCCAGCATGATTCTGTCTCGGCTGCGCGCTGTTCTCGAC
GGACTCGCCGCCTCGCTCAACGGAAACCCGGCCCTTCTGGCCAGGCTGCTCGCCTTCATCGTCGGACTGCTGATA
CTGGTCGGACATGGCGGTATCAGACGCCAGATCCAGCGCGTTCTGGCGGCTTCTTGGACCAAGTTCAAGACCACT
GCAGGCATGGGCACCAAGATCAGCTACATCTGA
Transcript >Ophun1|5928
ATGCCAGCAGCAACAACCGCCCGCAAGTACGGAAAATCATCGAAGCGGTCCAAGGCCGAGCGCCTCTTCGCCGAG
CTGCCTCAAAGCCCCGTGCGCGTCGACCCGTTATCTTGTCTCGCCGGGAAACTCGACGCGCTCCACATCCAAAGC
GACGCCGGGAAGAGGAGGGTAGAGCGACAGCCGCCTTCTCCGCGGAGGAAACAACCACCACCACCACCACCACCG
TCATCATCGCCGCGCAATGAGTCTACCTCTCCGCTTCAGGGCTCTCTCCGGGTCCTCACGTGGGAAGACGTCTGT
CCTGCCGGCGACGACATTGTCAAGATTGCAGAGGCTTCGTATGCAGAGGTCTATCGCGTCAGCAACGCGCGTGGC
ACGAGCATCATAAAGGCCATCCGCCTCGACTCGCCCATCAAGCGACAGACAAAAGCACAGGTGCGAGCGGGCCTC
GTAGACGAGGAACCGCATGCAGAAGCCGATGTCGATGGCGAGTTGCAGGTTTCCGAATGGTTGGCCGACGTGCCT
GGCTTCGTCGTCTACAAGGAGAAATACTTGGTTCGCGGCAAGGCCACCGGCAGGCTGCTCGAGACTCACCGGGCC
TTTCAGCAGAGAATGAAGAGGCAGGATCCGGGGCGGGCGCAGTTCTACCCGTCGCCGAGCCGATATCTCGAAGAT
ACCAGCTTTCTCGTCGTCGAGCTGGGTGACGCTGGCACCGCCTTGGAGGATTGGCACGTTGAGGACGAGAGCCAG
CTGTGGGACATCTTCCTCCTCGAGGCCGTAGCGCTGGCGAGAGCCGAGAATCTCGCCAAGTTCGAGCATCGCGAC
TTGCACGAGGGCAACATTTGCGTCAGACGTGTGAGCTCTCCGCGAAAGCGAGACGGCGACGACGGCTTCTTCGGC
TACTCCGGGCTCGAAATGACCATCCTCGACTACGGCCTCTCGCGCGCTCAAGACCCGGCAGACGACGAGGCCAAG
CCGGTAGCCTTTGACCTGGAAAGGGATCTCGGCCTCTTCAGCAGTACGCACGCGTCGCAGTGCGTCGTCTACCGC
CGGATGCGATCGTATCTCCTGCGCCGAGATCGCAAATGCATCCCAGCCGACGGACACAAGACGCCATACGCAAAG
GGAGTCGACGGGCCGCTGTCATGGGACGTATACGCGCCCTACACCAACGTGCTGTGGCTGGCCTACCTCTACCGC
TATCTCGCCGATAGCTTCGGTGGAAACAAGAGGGACCTGGCGCGCTTCAAGAGGGAGACGAAAGAGATGTGGCGG
CACCTGGATCCCGACGCAGCCGACGAGGTGTTGTGCTTTGGGTCGGCTGCTGACGTCGTCGGATTCGCCGTCGAG
GCGGGATGGATCCGGCAGGATCAACTGATCGGGACAGGGGCCTCGTTGCCGGACAAGGAGGATAGTATCATCTTG
GCTCATCCACAGGCTCATCCTCAGGCCCATCGACCAGCCATGGCCGTCTCCGGTCACGATGCCACGCTCGACGAC
TCCTTTCCGCGCGACCTGCTCTCTTCCTCTCTCTCGTCCTCCCTCTCCGCCTATTCCGTCGGCTCCTCGGCCGCC
TCGTCTACGGCCGCCCGTCGATCGTCGCAAATGTCAAAGACGTATCGCCAGGCTTCGACGCTCTTCCTGACCCGT
CGCCTGCCCGAGGCCCTGACGACGCTGACGCCCCTCATCGTCTCGCCCGAAAAGGATGAGCCGGCGCCCGTGGCA
AGGGCCTCCCGCACCACACGCATCAAGGTATGGAGCCTGTACCTGACCATCCTCCATGCCGTCGTCGAGATGGAA
CCCGACGACGGCAAGGAGGCCTTTGGCAACCAACAATGGAGGGCTCTGTGCCTCAAGGTCCGGGACGGCCTCATC
TGGGAGGAGGTGGTGAGGGATGGCTACCACGGCGTCGAGGGAGACGTCGACTCCGATGTCGTCATCAACCTGGCG
ACACTTCTCCTGGCGCACGCGCGCGATCAGACCTTGAATCAGCGCAGGCTCGAGACGTATCTGGCCACCTCCAAC
ACGCCGAACCTCGACCTGACAGTCCGTCCGGATAAGTCGCCCGTGCCGCGATCGCATGCCGGACCGCGACATCGG
TCTCCCGCTCCCGGCACGACCGGCGCCGAAACGCCGCGGGATCTCAACGCCCGCGTCAAGATACTGGAGCTGTAC
ACACTACACGTACTGCTGCGCAACAACGAGTGGGACTACGCCCGCGAGTTCATCAGCGTCAGTTCCGTCCTCGAC
GACGAGCGGCGCGAGGCCTTTCTCCAGGCCCTCGAGAGCCTGCAAGAGGAGCAGCAGGAACAGGAGCGGCAGGAG
AGGGCGGAGCGTCATCGCCAGGAGGAGCAGTTGCGTCGCCAGATCGACGATGCCAGACGGCTACGCGCCGAAAAT
GAAGAGTGGGAGAGGAAGCGGCTGGAAGACGAGGCGCGCCGGACGCGCCGCCCCAGCACCGAGGTCGATTATGGT
GTCGAGGCCAGTCCGACACCTGGTAGGCGGCATCAACGGATCTCGTCGCGCATGGCGGCCTCGTCGTCGGTCGGC
GGAAAGGCTGTCGCGCCCCGGACCTTTACGGCGCGGGCCAGCATGATTCTGTCTCGGCTGCGCGCTGTTCTCGAC
GGACTCGCCGCCTCGCTCAACGGAAACCCGGCCCTTCTGGCCAGGCTGCTCGCCTTCATCGTCGGACTGCTGATA
CTGGTCGGACATGGCGGTATCAGACGCCAGATCCAGCGCGTTCTGGCGGCTTCTTGGACCAAGTTCAAGACCACT
GCAGGCATGGGCACCAAGATCAGCTACATCTGA
Gene >Ophun1|5928
ATGCCAGCAGCAACAACCGCCCGCAAGTACGGAAAATCATCGAAGCGGTCCAAGGCCGAGCGCCTCTTCGCCGAG
CTGCCTCAAAGCCCCGTGCGCGTCGACCCGTTATCTTGTCTCGCCGGGAAACTCGACGCGCTCCACATCCAAAGC
GACGCCGGGAAGAGGAGGGTAGAGCGACAGCCGCCTTCTCCGCGGAGGAAACAACCACCACCACCACCACCACCG
TCATCATCGCCGCGCAATGAGTCTACCTCTCCGCTTCAGGGCTCTCTCCGGGTCCTCACGTGGGAAGACGTCTGT
CCTGCCGGCGACGACATTGTCAAGATTGCAGAGGCTTCGTATGCAGAGGTCTATCGCGTCAGCAACGCGCGTGGC
ACGAGCATCATAAAGGCCATCCGCCTCGACTCGCCCATCAAGCGACAGACAAAAGCACAGGTGCGAGCGGGCCTC
GTAGACGAGGAACCGCATGCAGAAGCCGATGTCGATGGCGAGTTGCAGGTTTCCGAATGGTTGGCCGACGTGCCT
GGCTTCGTCGTCTACAAGGAGAAATACTTGGTTCGCGGCAAGGCCACCGGCAGGCTGCTCGAGACTCACCGGGCC
TTTCAGCAGAGAATGAAGAGGCAGGATCCGGGGCGGGCGCAGTTCTACCCGTCGCCGAGCCGATATCTCGAAGAT
ACCAGCTTTCTCGTCGTCGAGCTGGGTGACGCTGGCACCGCCTTGGAGGATTGGCACGTTGAGGACGAGAGCCAG
CTGTGGGACATCTTCCTCCTCGAGGCCGTAGCGCTGGCGAGAGCCGAGAATCTCGCCAAGTTCGAGGTGAGATGA
AGCCAGTTTGAAGTCTCGACGTTGCTGCGCCCAGGACTGACACTCTTCTGAAAACATAGCATCGCGACTTGCACG
AGGGCAACATTTGCGTCAGACGTGTGAGCTCTCCGCGAAAGCGAGACGGCGACGACGGCTTCTTCGGCTACTCCG
GGCTCGAAATGACCATCCTCGACTACGGCCTCTCGCGCGCTCAAGACCCGGCAGACGACGAGGCCAAGCCGGTAG
CCTTTGACCTGGAAAGGGATCTCGGCCTCTTCAGCAGTACGCACGCGTCGCAGTGCGTCGTCTACCGCCGGATGC
GATCGTATCTCCTGCGCCGAGATCGCAAATGCATCCCAGCCGACGGACACAAGACGCCATACGCAAAGGGAGTCG
ACGGGCCGCTGTCATGGGACGTATACGCGCCCTACACCAACGTGCTGTGGCTGGCCTACCTCTACCGCTATCTCG
CCGATAGCTTCGGTGGAAACAAGAGGGACCTGGCGCGCTTCAAGAGGGAGACGAAAGAGATGTGGCGGCACCTGG
ATCCCGACGCAGCCGACGAGGTGTTGTGCTTTGGGTCGGCTGCTGACGTCGTCGGATTCGCCGTCGAGGCGGGAT
GGATCCGGCAGGATCAACTGATCGGGACAGGGGCCTCGTTGCCGGACAAGGAGGATAGTATCATCTTGGTGAGTC
GAGGCGAGGACGAGCGGGCAGGGCGGCCGCCGAGGAGGACGAGGAGAGGGATGGCAGCGTCGTAGCTGCTTGTGT
CGTCTCCCTCCCCTTGTGCGTGTGTTTTGTATGCAAGAAGCCGGCGATATGTAGTTGAGACAGGTGCAGATCTCT
CGGAGATGAAGCTTGAACAGGTAGAAGTTACATGCATACGGGCTGCAGGCATTCGTTTGAAGTCAAGAGCATCAA
GATGCTGGTTCAAATTTCGTCCTCCAAGTCTCGACAACGAGCGGGCCGGTGCGGAGAAACAAAACATCCGCCGCC
TCTGACGGAACAGACCCCTGCCAGATCAGAGATAGTGCAGTACAAACAGCCCCCGCAGAAAATGCAATGTTGCAT
GAGTGCCGCCCTAGCAGATCCCCGACCCCAGACGCCCTCGTGACGCGAGCCGAGGCTATCAGAACGGCCGAACCG
GGGAATGCAATCTTGTGTGTTGACCAACAGCCACATGTCATGGCCCACTGCACTTCTATCGCGACCTTCCATTCC
TCCTGACGATGGAATCTTTGATGCCTCACAACAGCACGTTGCTCTCTGACCTCTTGCTCGTCTGCTGAGACGAGG
GATTGCCATTCACAGGCTCATCCACAGGCTCATCCTCAGGCCCATCGACCAGCCATGGCCGTCTCCGGTCACGAT
GCCACGCTCGACGACTCCTTTCCGCGCGACCTGCTCTCTTCCTCTCTCTCGTCCTCCCTCTCCGCCTATTCCGTC
GGCTCCTCGGCCGCCTCGTCTACGGCCGCCCGTCGATCGTCGCAAATGTCAAAGACGTATCGCCAGGCTTCGACG
CTCTTCCTGACCCGTCGCCTGCCCGAGGCCCTGACGACGCTGACGCCCCTCATCGTCTCGCCCGAAAAGGATGAG
CCGGCGCCCGTGGCAAGGGCCTCCCGCACCACACGCATCAAGGTATGGAGCCTGTACCTGACCATCCTCCATGCC
GTCGTCGAGATGGAACCCGACGACGGCAAGGAGGCCTTTGGCAACCAACAATGGAGGGCTCTGTGCCTCAAGGTC
CGGGACGGCCTCATCTGGGAGGAGGTGGTGAGGGATGGCTACCACGGCGTCGAGGGAGACGTCGACTCCGATGTC
GTCATCAACCTGTGAGTCCTCTCTGCTCGGGAAACTCGTCGCCTCTTTGGCCGAGCTGATTTTGGACTGACTTTG
ACGCTGCCAAGGGCGACACTTCTCCTGGCGCACGCGCGCGATCAGACCTTGAATCAGCGCAGGCTCGAGACGTAT
CTGGCCACCTCCAACACGCCGAACCTCGACCTGACAGTCCGTCCGGATAAGTCGCCCGTGCCGCGATCGCATGCC
GGACCGCGACATCGGTCTCCCGCTCCCGGCACGACCGGCGCCGAAACGCCGCGGGATCTCAACGCCCGCGTCAAG
ATACTGGAGCTGTACACACTACACGTACTGCTGCGCAACAACGAGTGGGACTACGCCCGCGAGTTCATCAGCGTC
AGTTCCGTCCTCGACGACGAGCGGCGCGAGGCCTTTCTCCAGGCCCTCGAGAGCCTGCAAGAGGAGCAGCAGGAA
CAGGAGCGGCAGGAGAGGGCGGAGCGTCATCGCCAGGAGGAGCAGTTGCGTCGCCAGATCGACGATGCCAGACGG
CTACGCGCCGAAAATGAAGAGTGGGAGAGGAAGCGGCTGGAAGACGAGGCGCGCCGGACGCGCCGCCCCAGCACC
GAGGTCGATTATGGTGTCGAGGCCAGTCCGACACCTGGTAGGCGGCATCAACGGATCTCGTCGCGCATGGCGGCC
TCGTCGTCGGTCGGCGGAAAGGCTGTCGCGCCCCGGACCTTTACGGCGCGGGCCAGCATGATTCTGTCTCGGCTG
CGCGCTGTTCTCGACGGACTCGCCGCCTCGCTCAACGGAAACCCGGCCCTTCTGGCCAGGCTGCTCGCCTTCATC
GTCGGACTGCTGATACTGGTCGGACATGGCGGTATCAGACGCCAGATCCAGCGCGTTCTGGCGGCTTCTTGGACC
AAGTTCAAGACCACTGCAGGCATGGGCACCAAGATCAGCTACATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail