Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5927
Gene name
LocationContig_611:1554..3202
Strand-
Gene length (bp)1648
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07946 CCDC47 PAT complex subunit CCDC47 2.1E-109 103 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94280|YGX1_SCHPO UPF0674 endoplasmic reticulum membrane protein C2G5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G5.01 PE=3 SV=1 103 401 1.0E-15
sp|P53723|YN8B_YEAST UPF0674 endoplasmic reticulum membrane protein YNR021W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR021W PE=1 SV=3 73 455 3.0E-15
sp|Q66I12|CCD47_DANRE Coiled-coil domain-containing protein 47 OS=Danio rerio GN=ccdc47 PE=2 SV=1 110 420 3.0E-11
sp|Q6AZI2|CCD47_XENLA Coiled-coil domain-containing protein 47 OS=Xenopus laevis GN=ccdc47 PE=2 SV=1 110 457 3.0E-11
sp|Q5RCI4|CCD47_PONAB Coiled-coil domain-containing protein 47 OS=Pongo abelii GN=CCDC47 PE=2 SV=2 110 457 8.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94280|YGX1_SCHPO UPF0674 endoplasmic reticulum membrane protein C2G5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G5.01 PE=3 SV=1 103 401 1.0E-15
sp|P53723|YN8B_YEAST UPF0674 endoplasmic reticulum membrane protein YNR021W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR021W PE=1 SV=3 73 455 3.0E-15
sp|Q66I12|CCD47_DANRE Coiled-coil domain-containing protein 47 OS=Danio rerio GN=ccdc47 PE=2 SV=1 110 420 3.0E-11
sp|Q6AZI2|CCD47_XENLA Coiled-coil domain-containing protein 47 OS=Xenopus laevis GN=ccdc47 PE=2 SV=1 110 457 3.0E-11
sp|Q5RCI4|CCD47_PONAB Coiled-coil domain-containing protein 47 OS=Pongo abelii GN=CCDC47 PE=2 SV=2 110 457 8.0E-11
sp|P0C204|CCD47_MACFA Coiled-coil domain-containing protein 47 OS=Macaca fascicularis GN=CCDC47 PE=2 SV=1 110 457 2.0E-10
sp|Q96A33|CCD47_HUMAN Coiled-coil domain-containing protein 47 OS=Homo sapiens GN=CCDC47 PE=1 SV=1 110 457 3.0E-10
sp|Q3ZC50|CCD47_BOVIN Coiled-coil domain-containing protein 47 OS=Bos taurus GN=CCDC47 PE=2 SV=1 110 457 6.0E-10
sp|Q5U2X6|CCD47_RAT Coiled-coil domain-containing protein 47 OS=Rattus norvegicus GN=Ccdc47 PE=2 SV=1 110 457 7.0E-10
sp|Q9D024|CCD47_MOUSE Coiled-coil domain-containing protein 47 OS=Mus musculus GN=Ccdc47 PE=1 SV=2 110 457 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0032469 endoplasmic reticulum calcium ion homeostasis Yes
GO:0005509 calcium ion binding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0055082 cellular chemical homeostasis No
GO:0072507 divalent inorganic cation homeostasis No
GO:0048878 chemical homeostasis No
GO:0043226 organelle No
GO:0006873 cellular ion homeostasis No
GO:0043229 intracellular organelle No
GO:0098771 inorganic ion homeostasis No
GO:0055065 metal ion homeostasis No
GO:0019725 cellular homeostasis No
GO:0046872 metal ion binding No
GO:0050801 ion homeostasis No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0065008 regulation of biological quality No
GO:0055074 calcium ion homeostasis No
GO:0072503 cellular divalent inorganic cation homeostasis No
GO:0042592 homeostatic process No
GO:0043167 ion binding No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0006875 cellular metal ion homeostasis No
GO:0030003 cellular cation homeostasis No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0055080 cation homeostasis No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006874 cellular calcium ion homeostasis No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 108 127 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5927
MVREAEKFVSFYTRLTSLVMAQRLLQSLFGGNQPPAPAAKPLDADFADFAADSAGAPEAVPEAIPEPGPGKATLT
AAAAAASPTSQQPWTKWYRVQDRHSLSEFKAEGVILAIVALILVLHVLGARVNRAKARAWMRANAAVLRSEFALV
GFGDVATMDREGVSAEGLLRENSLFEFATYATGRQNAAFMDVKLTLAKRFNPVLSTIEAVAAVFSEMFAPPADMM
EAVLYPFDGKEELTVPKPPGEDSRKDSRSTYEGFVWAIVHKDRMQKLREERYDVTLASTRDNAKLPAWLTVMSES
PEITDALLTKELTAAVTAAGDLFEYVIVSDQPVDKPKSMEETTPRKRLFLRYRLPSSDDYSALTPLLTSFARLPD
VLVQSARFRPEVMRKVRATREAMMAQLKKAHDEERNEERLAEKEKSRKAKRDAELKGLDAKAQKKYLEKEREKEM
RRNQKKMTMRG*
Coding >Ophun1|5927
ATGGTCCGTGAGGCTGAAAAATTCGTCAGCTTCTACACGCGCCTGACGAGCCTAGTCATGGCCCAGCGCCTTCTG
CAGAGCCTCTTTGGCGGCAACCAACCCCCGGCTCCGGCAGCCAAGCCGCTCGACGCAGACTTTGCCGACTTCGCT
GCAGACTCGGCGGGCGCTCCGGAAGCAGTGCCGGAAGCGATCCCGGAGCCCGGTCCTGGAAAGGCGACTCTCACC
GCTGCCGCCGCCGCAGCCTCGCCGACGAGCCAGCAGCCATGGACCAAGTGGTATAGAGTACAGGATCGGCACTCG
CTATCCGAGTTCAAGGCAGAGGGCGTCATCCTTGCCATCGTGGCCTTGATTCTGGTGCTGCACGTTCTGGGCGCG
CGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTGCTACGATCCGAATTCGCCCTCGTC
GGCTTCGGCGACGTAGCGACAATGGACAGAGAGGGCGTGAGCGCTGAGGGGCTACTCCGTGAGAACTCGCTGTTC
GAGTTCGCGACGTATGCGACGGGACGACAGAATGCGGCCTTTATGGACGTCAAGCTCACGCTGGCCAAGCGATTC
AATCCCGTCCTCAGCACCATCGAGGCCGTCGCCGCCGTCTTCTCCGAAATGTTCGCCCCTCCGGCCGACATGATG
GAGGCGGTGCTCTACCCCTTTGACGGAAAGGAAGAGCTGACGGTCCCGAAACCGCCCGGCGAAGATAGCCGCAAG
GACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTTCACAAAGACCGGATGCAGAAGCTGCGCGAGGAG
CGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCCGCCTGGCTGACGGTCATGAGCGAGAGC
CCCGAAATCACAGACGCGCTCCTCACCAAGGAGCTGACGGCGGCGGTGACGGCGGCCGGTGATCTGTTCGAATAC
GTCATCGTTAGCGACCAGCCCGTCGACAAGCCCAAGTCAATGGAGGAGACGACACCGCGCAAGCGTCTCTTCCTC
CGCTACCGACTCCCCAGCTCAGACGACTACAGCGCGCTGACGCCGCTTCTCACGAGCTTCGCCCGCCTCCCCGAC
GTGCTGGTCCAGTCAGCGCGCTTCCGACCAGAGGTGATGCGCAAGGTCCGCGCCACGCGAGAAGCCATGATGGCG
CAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGTCTGGCGGAGAAGGAGAAGTCGCGCAAGGCCAAG
CGCGATGCCGAGCTCAAGGGCCTGGACGCCAAGGCGCAGAAGAAGTATCTGGAGAAGGAGAGAGAGAAGGAGATG
CGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA
Transcript >Ophun1|5927
ATGGTCCGTGAGGCTGAAAAATTCGTCAGCTTCTACACGCGCCTGACGAGCCTAGTCATGGCCCAGCGCCTTCTG
CAGAGCCTCTTTGGCGGCAACCAACCCCCGGCTCCGGCAGCCAAGCCGCTCGACGCAGACTTTGCCGACTTCGCT
GCAGACTCGGCGGGCGCTCCGGAAGCAGTGCCGGAAGCGATCCCGGAGCCCGGTCCTGGAAAGGCGACTCTCACC
GCTGCCGCCGCCGCAGCCTCGCCGACGAGCCAGCAGCCATGGACCAAGTGGTATAGAGTACAGGATCGGCACTCG
CTATCCGAGTTCAAGGCAGAGGGCGTCATCCTTGCCATCGTGGCCTTGATTCTGGTGCTGCACGTTCTGGGCGCG
CGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTGCTACGATCCGAATTCGCCCTCGTC
GGCTTCGGCGACGTAGCGACAATGGACAGAGAGGGCGTGAGCGCTGAGGGGCTACTCCGTGAGAACTCGCTGTTC
GAGTTCGCGACGTATGCGACGGGACGACAGAATGCGGCCTTTATGGACGTCAAGCTCACGCTGGCCAAGCGATTC
AATCCCGTCCTCAGCACCATCGAGGCCGTCGCCGCCGTCTTCTCCGAAATGTTCGCCCCTCCGGCCGACATGATG
GAGGCGGTGCTCTACCCCTTTGACGGAAAGGAAGAGCTGACGGTCCCGAAACCGCCCGGCGAAGATAGCCGCAAG
GACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTTCACAAAGACCGGATGCAGAAGCTGCGCGAGGAG
CGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCCGCCTGGCTGACGGTCATGAGCGAGAGC
CCCGAAATCACAGACGCGCTCCTCACCAAGGAGCTGACGGCGGCGGTGACGGCGGCCGGTGATCTGTTCGAATAC
GTCATCGTTAGCGACCAGCCCGTCGACAAGCCCAAGTCAATGGAGGAGACGACACCGCGCAAGCGTCTCTTCCTC
CGCTACCGACTCCCCAGCTCAGACGACTACAGCGCGCTGACGCCGCTTCTCACGAGCTTCGCCCGCCTCCCCGAC
GTGCTGGTCCAGTCAGCGCGCTTCCGACCAGAGGTGATGCGCAAGGTCCGCGCCACGCGAGAAGCCATGATGGCG
CAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGTCTGGCGGAGAAGGAGAAGTCGCGCAAGGCCAAG
CGCGATGCCGAGCTCAAGGGCCTGGACGCCAAGGCGCAGAAGAAGTATCTGGAGAAGGAGAGAGAGAAGGAGATG
CGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA
Gene >Ophun1|5927
ATGGTCCGTGAGGCTGAAAAGTATGTACACAAGAGGTCTTGTTGGCACGACAACGCGCTCAAACGGGCCTAGTGC
GAACCCCGGACTGGGGCTTCTCCACAGTCGATGGCCCGATAGAACATCCGAGGAAGTTGTTGGTGGCTGTTGGGC
TGAAGCCTTTTTTCCCTCACCGGCTTCTTCCTCTGCTCGGCCGTCTTGCTTCTGTTCCGTCTCCTTTTCGTCAGA
TTCGTCAGCTTCTACACGCGCCTGACGAGCCTAGTCATGGCCCAGCGCCTTCTGCAGAGCCTCTTTGGCGGCAAC
CAACCCCCGGCTCCGGCAGCCAAGCCGCTCGACGCAGGTAAAGCTTGCGAAACCCTCTCTCTCCCTCTCCCTCTC
ATCTCACTGACCTCTCGTAGACTTTGCCGACTTCGCTGCAGACTCGGCGGGCGCTCCGGAAGCAGTGCCGGAAGC
GATCCCGGAGCCCGGTCCTGGAAAGGCGACTCTCACCGCTGCCGCCGCCGCAGCCTCGCCGACGAGCCAGCAGCC
ATGGACCAAGTGGTATAGAGTACAGGATCGGCACTCGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTTGCCAT
CGTGGCCTTGATTCTGGTGCTGCACGTTCTGGGCGCGCGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGC
CAACGCGGCGGTGCTACGATCCGAATTCGCCCTCGTCGGCTTCGGCGACGTAGCGACAATGGACAGAGAGGGCGT
GAGCGCTGAGGGGCTACTCCGTGAGAACTCGCTGTTCGAGTTCGCGACGTATGCGACGGGACGACAGAATGCGGC
CTTTATGGACGTCAAGCTCACGCTGGCCAAGCGATTCAATCCCGTCCTCAGCACCATCGAGGCCGTCGCCGCCGT
CTTCTCCGAAATGTTCGCCCCTCCGGCCGACATGATGGAGGCGGTGCTCTACCCCTTTGACGGAAAGGAAGAGCT
GACGGTCCCGAAACCGCCCGGCGAAGATAGCCGCAAGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCAT
TGTTCACAAAGACCGGATGCAGAAGCTGCGCGAGGAGCGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGC
CAAGCTACCCGCCTGGCTGACGGTCATGAGCGAGAGCCCCGAAATCACAGACGCGCTCCTCACCAAGGAGCTGAC
GGCGGCGGTGACGGCGGCCGGTGATCTGTTCGAATACGTCATCGTTAGCGACCAGCCCGTCGACAAGCCCAAGTC
AATGGAGGAGACGACACCGCGCAAGCGTCTCTTCCTCCGCTACCGACTCCCCAGCTCAGACGACTACAGCGCGCT
GACGCCGCTTCTCACGAGCTTCGCCCGCCTCCCCGACGTGCTGGTCCAGTCAGCGCGCTTCCGACCAGAGGTGAT
GCGCAAGGTCCGCGCCACGCGAGAAGCCATGATGGCGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGA
GCGTCTGGCGGAGAAGGAGAAGTCGCGCAAGGCCAAGCGCGATGCCGAGCTCAAGGGCCTGGACGCCAAGGCGCA
GAAGAAGTATCTGGAGAAGGAGAGAGAGAAGGAGATGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail