Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5921
Gene name
LocationContig_61:42147..44920
Strand+
Gene length (bp)2773
Transcript length (bp)2718
Coding sequence length (bp)2718
Protein length (aa) 906

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.5E-20 493 803
PF00400 WD40 WD domain, G-beta repeat 7.7E-02 27 59
PF00400 WD40 WD domain, G-beta repeat 1.5E-02 207 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38149|DUG2_YEAST Probable di- and tripeptidase DUG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG2 PE=1 SV=1 23 905 5.0E-152
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 415 898 3.0E-61
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 415 898 1.0E-60
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 415 898 5.0E-58
sp|Q3ZC84|CNDP2_BOVIN Cytosolic non-specific dipeptidase OS=Bos taurus GN=CNDP2 PE=2 SV=1 414 898 8.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38149|DUG2_YEAST Probable di- and tripeptidase DUG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG2 PE=1 SV=1 23 905 5.0E-152
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 415 898 3.0E-61
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 415 898 1.0E-60
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 415 898 5.0E-58
sp|Q3ZC84|CNDP2_BOVIN Cytosolic non-specific dipeptidase OS=Bos taurus GN=CNDP2 PE=2 SV=1 414 898 8.0E-58
sp|Q5R432|CNDP2_PONAB Cytosolic non-specific dipeptidase OS=Pongo abelii GN=CNDP2 PE=2 SV=1 415 898 4.0E-57
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 408 899 1.0E-53
sp|Q9P6I2|DUG1_SCHPO Cys-Gly metallodipeptidase dug1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dug1 PE=2 SV=2 415 898 1.0E-51
sp|Q8BUG2|CNDP1_MOUSE Beta-Ala-His dipeptidase OS=Mus musculus GN=Cndp1 PE=2 SV=1 415 905 2.0E-51
sp|Q96KN2|CNDP1_HUMAN Beta-Ala-His dipeptidase OS=Homo sapiens GN=CNDP1 PE=1 SV=4 415 905 2.0E-48
sp|Q66HG3|CNDP1_RAT Beta-Ala-His dipeptidase OS=Rattus norvegicus GN=Cndp1 PE=1 SV=1 415 905 7.0E-48
sp|P43616|DUG1_YEAST Cys-Gly metallodipeptidase DUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG1 PE=1 SV=1 473 891 3.0E-44
sp|Q5P9A2|DAPE_ANAMM Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain St. Maries) GN=dapE PE=3 SV=2 422 649 2.0E-10
sp|B9KHC9|DAPE_ANAMF Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain Florida) GN=dapE PE=3 SV=2 422 649 2.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 30 323 2.0E-10
sp|A9HKR2|DAPE_GLUDA Succinyl-diaminopimelate desuccinylase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapE PE=3 SV=1 451 648 7.0E-10
sp|Q5GS68|DAPE_WOLTR Succinyl-diaminopimelate desuccinylase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dapE PE=3 SV=1 428 654 4.0E-09
sp|Q9K9G9|FAPD_BACHD N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine deformylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ylmB PE=1 SV=1 414 620 8.0E-09
sp|Q2L2J6|DAPE_BORA1 Succinyl-diaminopimelate desuccinylase OS=Bordetella avium (strain 197N) GN=dapE PE=3 SV=1 421 565 3.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 19 404 3.0E-08
sp|A4SYV9|DAPE_POLSQ Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dapE PE=3 SV=1 472 611 2.0E-07
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 494 648 2.0E-07
sp|Q21WT4|DAPE_RHOFT Succinyl-diaminopimelate desuccinylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapE PE=3 SV=1 436 650 3.0E-07
sp|Q7WKC6|DAPE_BORBR Succinyl-diaminopimelate desuccinylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dapE PE=3 SV=1 423 565 4.0E-07
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 194 407 4.0E-07
sp|Q7W8Y3|DAPE_BORPA Succinyl-diaminopimelate desuccinylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dapE PE=3 SV=1 423 565 4.0E-07
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 194 407 5.0E-07
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 492 617 6.0E-07
sp|B3CLN1|DAPE_WOLPP Succinyl-diaminopimelate desuccinylase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dapE PE=3 SV=1 428 649 7.0E-07
sp|Q3J9B0|DAPE_NITOC Succinyl-diaminopimelate desuccinylase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapE PE=3 SV=1 487 648 8.0E-07
sp|Q7VRT2|DAPE_BLOFL Succinyl-diaminopimelate desuccinylase OS=Blochmannia floridanus GN=dapE PE=3 SV=1 443 590 8.0E-07
sp|B0T134|DAPE_CAUSK Succinyl-diaminopimelate desuccinylase OS=Caulobacter sp. (strain K31) GN=dapE PE=3 SV=2 455 666 1.0E-06
sp|Q0KA02|DAPE_CUPNH Succinyl-diaminopimelate desuccinylase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dapE PE=3 SV=1 442 565 1.0E-06
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 211 403 1.0E-06
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 477 617 2.0E-06
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 278 429 2.0E-06
sp|Q91WM3|U3IP2_MOUSE U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1 30 303 2.0E-06
sp|Q5WY21|DAPE_LEGPL Succinyl-diaminopimelate desuccinylase OS=Legionella pneumophila (strain Lens) GN=dapE PE=3 SV=1 421 648 2.0E-06
sp|Q2Y7X4|DAPE_NITMU Succinyl-diaminopimelate desuccinylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapE PE=3 SV=1 455 617 2.0E-06
sp|B9JZL9|DAPE_AGRVS Succinyl-diaminopimelate desuccinylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dapE PE=3 SV=1 451 565 2.0E-06
sp|O43818|U3IP2_HUMAN U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 10 302 3.0E-06
sp|B1XTT6|DAPE_POLNS Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=dapE PE=3 SV=1 472 611 3.0E-06
sp|Q21HG2|DAPE_SACD2 Succinyl-diaminopimelate desuccinylase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dapE PE=3 SV=1 492 565 3.0E-06
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 490 565 3.0E-06
sp|A6WYL3|DAPE_OCHA4 Succinyl-diaminopimelate desuccinylase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dapE PE=3 SV=1 449 565 3.0E-06
sp|B3R2D1|DAPE_CUPTR Succinyl-diaminopimelate desuccinylase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dapE PE=3 SV=1 442 565 3.0E-06
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 478 617 4.0E-06
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 490 617 5.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 223 402 5.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 13 323 6.0E-06
sp|Q470C3|DAPE_CUPPJ Succinyl-diaminopimelate desuccinylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dapE PE=3 SV=1 488 617 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5921
MPSVTAQPDLTSPSSESPHSSPRLVHGLEHGSSVLALAVSPEHNAIFAGTQDGEIVVWSLATFHQVHLVQAHKRS
VLSLFLSPDRSLLFSSAGDPIVNVWCPKTLRRLYEIYGVHDVGDIFCTAYSAQRDALYIGAQNTSIQWVGLADTA
SRVAAGSQRHPDRRSHRFFDSKAIGGSSTPRRNDGRWNLIPRAQAVLEIDGSSIRRFAHNGYVYCMLMATGPTVE
VDADDDVLISGGGDGTIKLWTLGGRRRCRDEGRDEAGSGGIEELMTLGSDDAESVLSLALDGSFLYAGKLDGIVE
LWDLDTTQRLRVIKAHGGNVMSLQMGWGHLWTASTNGCASRYSTAHYGAYSHASSGDVSQKYQCLSKWNAHEGKI
LASAVTTYGHHKYFITGANDRSISIWSIKDKDLPERPATDGNEDLLISTLADFVSYKTVSSRPDHAEDCRKGATF
LGALLKRLGGDVEMLSTDKAHNPLVYARFAGKKESAQDRKRILFYGHYDVVAADTRKGKWLTDPFTLKGTNGFLY
GRGVSDNKGPIVAAVYAVTELMQAQKLENDVVFLIEGEEEFGSRGFEEAVRRHKHLIGHVDYILLANSYWLDDEV
PCLTYGLRGVLHATVCVDAPRPDLHSGVDGSYLVNEPLSDLTSILSRLKGGGNRIQIPGFYDGVPPMGPEEEARF
DEIASMLTRHGADEKTTTKMTRQTLKQSLMARWREPNLTIHRYKVSGPEGSLVSSHASSHISLRLVPGQEVEEVA
EALAWFLRREFSLLRSQNRLTVNIDNKAEPWLGDPTNAIFRTLGQAIVEAWPGCFGRGGAKQDRDAGEDEEEGKT
RRAAAADEEASKPVKPKQPLYIREGGSIPAIRFLEKEFGAPAAHLPCGRASDAAHLDNERICMVNLFKAKEIFGK
VFARL*
Coding >Ophun1|5921
ATGCCGTCTGTCACCGCCCAGCCAGACCTCACTTCGCCCTCGAGCGAGTCGCCTCATAGCTCTCCGCGGCTCGTT
CACGGCCTCGAGCATGGCAGCTCCGTGCTCGCTCTCGCAGTCAGCCCTGAGCACAATGCCATCTTCGCCGGCACT
CAGGACGGAGAGATTGTCGTCTGGTCGCTGGCCACCTTTCATCAGGTACACCTCGTCCAGGCTCACAAGCGCAGC
GTCCTCTCCCTCTTTCTCTCTCCCGACCGCTCTCTTCTCTTCTCGAGCGCCGGCGATCCAATTGTCAACGTTTGG
TGTCCCAAGACGCTGCGGCGCCTGTACGAGATCTACGGCGTTCACGATGTGGGCGACATCTTCTGCACCGCCTAT
AGCGCCCAGCGAGATGCCCTCTACATAGGCGCTCAGAACACGTCAATCCAATGGGTGGGCTTGGCCGACACCGCC
TCGCGTGTCGCCGCGGGCTCGCAACGGCACCCGGACCGCAGGAGTCATCGCTTCTTCGACTCCAAGGCCATTGGC
GGCTCGAGCACGCCCAGGAGGAACGACGGCCGGTGGAATTTGATCCCGCGCGCTCAGGCTGTTCTCGAGATTGAC
GGAAGCTCTATCCGACGCTTTGCCCACAACGGCTACGTATATTGCATGCTCATGGCCACGGGGCCCACGGTCGAG
GTAGACGCCGACGACGACGTCCTGATATCTGGCGGTGGTGACGGTACAATCAAGCTTTGGACCCTTGGAGGCCGG
CGTCGTTGCCGTGATGAGGGTCGAGACGAGGCCGGCAGTGGCGGGATCGAGGAGCTCATGACGCTGGGCAGCGAT
GATGCCGAATCGGTCTTGTCTCTCGCCCTCGACGGCTCCTTTCTATACGCTGGGAAGCTTGACGGCATCGTCGAG
CTATGGGATCTGGACACCACTCAGAGACTGAGGGTCATCAAGGCGCACGGAGGAAACGTCATGTCGCTGCAGATG
GGATGGGGTCATCTCTGGACAGCATCGACCAACGGCTGTGCGAGTAGGTACAGCACAGCCCATTACGGTGCCTAT
AGCCATGCCTCGTCCGGAGACGTTAGCCAGAAATACCAATGTCTGAGCAAATGGAACGCCCATGAGGGCAAGATC
CTGGCCTCAGCCGTCACCACCTACGGCCATCACAAGTACTTCATCACCGGGGCCAACGATCGCAGCATATCCATA
TGGTCAATCAAGGACAAGGACCTGCCGGAGAGGCCGGCGACGGATGGCAACGAGGATCTGCTCATCTCTACTCTC
GCCGACTTTGTCTCGTACAAGACGGTCTCGTCTCGACCGGATCACGCTGAGGACTGCCGTAAGGGCGCTACCTTT
CTCGGCGCGCTTCTCAAGCGCCTCGGTGGTGACGTCGAGATGCTCAGCACTGACAAGGCGCATAACCCCCTCGTT
TACGCACGCTTCGCGGGCAAGAAGGAGTCTGCTCAGGACCGGAAACGCATTCTCTTCTACGGCCACTACGATGTC
GTCGCTGCAGACACTCGCAAGGGCAAATGGCTGACGGATCCCTTCACGCTCAAGGGAACCAACGGTTTTCTCTAC
GGCCGCGGCGTCAGCGACAACAAAGGCCCCATTGTCGCTGCTGTTTACGCGGTGACGGAACTGATGCAGGCGCAG
AAGCTGGAGAACGATGTCGTTTTCCTCATCGAGGGGGAGGAAGAGTTTGGTTCGAGGGGCTTTGAGGAGGCCGTC
AGGAGGCACAAGCATCTCATCGGCCACGTCGACTACATCCTACTCGCCAATAGCTACTGGCTCGACGACGAGGTT
CCCTGCCTCACGTACGGTCTCCGGGGTGTTCTCCACGCGACTGTCTGCGTCGACGCGCCCCGTCCTGATCTACAC
TCGGGTGTCGACGGCTCCTACTTGGTCAACGAGCCGCTGTCAGACTTGACCAGCATTCTGTCGAGGCTCAAGGGC
GGCGGCAACAGGATACAGATCCCGGGATTCTACGATGGCGTGCCGCCTATGGGACCCGAGGAGGAGGCGAGGTTC
GACGAGATTGCGTCAATGTTAACGCGTCATGGCGCAGACGAGAAGACGACGACCAAGATGACGAGGCAGACGCTC
AAGCAATCGCTTATGGCGCGCTGGCGAGAGCCCAACCTCACCATCCACCGCTACAAGGTGTCGGGCCCGGAGGGC
AGCCTGGTGAGCAGCCACGCGAGCTCGCATATCAGCCTGCGGCTGGTACCAGGGCAGGAGGTCGAGGAAGTGGCC
GAGGCGCTGGCCTGGTTTCTGCGACGCGAGTTCTCGCTGCTCCGGTCGCAGAACCGGCTGACAGTCAATATCGAC
AACAAGGCCGAGCCCTGGCTGGGTGACCCGACCAACGCCATCTTCCGCACGCTGGGACAGGCCATTGTCGAGGCC
TGGCCTGGCTGCTTCGGCCGCGGGGGCGCGAAGCAGGACAGGGACGCTGGAGAGGACGAGGAGGAGGGAAAGACG
AGGAGGGCGGCGGCAGCTGACGAGGAGGCGTCGAAGCCCGTCAAGCCGAAGCAGCCGCTGTATATCCGCGAGGGC
GGCTCCATCCCGGCCATCCGCTTCCTGGAGAAGGAGTTTGGCGCGCCGGCGGCTCATCTGCCGTGTGGGAGGGCC
AGTGACGCGGCCCATTTGGATAATGAGCGGATCTGTATGGTGAATCTTTTCAAGGCCAAGGAGATTTTCGGCAAG
GTGTTTGCGAGATTGTAG
Transcript >Ophun1|5921
ATGCCGTCTGTCACCGCCCAGCCAGACCTCACTTCGCCCTCGAGCGAGTCGCCTCATAGCTCTCCGCGGCTCGTT
CACGGCCTCGAGCATGGCAGCTCCGTGCTCGCTCTCGCAGTCAGCCCTGAGCACAATGCCATCTTCGCCGGCACT
CAGGACGGAGAGATTGTCGTCTGGTCGCTGGCCACCTTTCATCAGGTACACCTCGTCCAGGCTCACAAGCGCAGC
GTCCTCTCCCTCTTTCTCTCTCCCGACCGCTCTCTTCTCTTCTCGAGCGCCGGCGATCCAATTGTCAACGTTTGG
TGTCCCAAGACGCTGCGGCGCCTGTACGAGATCTACGGCGTTCACGATGTGGGCGACATCTTCTGCACCGCCTAT
AGCGCCCAGCGAGATGCCCTCTACATAGGCGCTCAGAACACGTCAATCCAATGGGTGGGCTTGGCCGACACCGCC
TCGCGTGTCGCCGCGGGCTCGCAACGGCACCCGGACCGCAGGAGTCATCGCTTCTTCGACTCCAAGGCCATTGGC
GGCTCGAGCACGCCCAGGAGGAACGACGGCCGGTGGAATTTGATCCCGCGCGCTCAGGCTGTTCTCGAGATTGAC
GGAAGCTCTATCCGACGCTTTGCCCACAACGGCTACGTATATTGCATGCTCATGGCCACGGGGCCCACGGTCGAG
GTAGACGCCGACGACGACGTCCTGATATCTGGCGGTGGTGACGGTACAATCAAGCTTTGGACCCTTGGAGGCCGG
CGTCGTTGCCGTGATGAGGGTCGAGACGAGGCCGGCAGTGGCGGGATCGAGGAGCTCATGACGCTGGGCAGCGAT
GATGCCGAATCGGTCTTGTCTCTCGCCCTCGACGGCTCCTTTCTATACGCTGGGAAGCTTGACGGCATCGTCGAG
CTATGGGATCTGGACACCACTCAGAGACTGAGGGTCATCAAGGCGCACGGAGGAAACGTCATGTCGCTGCAGATG
GGATGGGGTCATCTCTGGACAGCATCGACCAACGGCTGTGCGAGTAGGTACAGCACAGCCCATTACGGTGCCTAT
AGCCATGCCTCGTCCGGAGACGTTAGCCAGAAATACCAATGTCTGAGCAAATGGAACGCCCATGAGGGCAAGATC
CTGGCCTCAGCCGTCACCACCTACGGCCATCACAAGTACTTCATCACCGGGGCCAACGATCGCAGCATATCCATA
TGGTCAATCAAGGACAAGGACCTGCCGGAGAGGCCGGCGACGGATGGCAACGAGGATCTGCTCATCTCTACTCTC
GCCGACTTTGTCTCGTACAAGACGGTCTCGTCTCGACCGGATCACGCTGAGGACTGCCGTAAGGGCGCTACCTTT
CTCGGCGCGCTTCTCAAGCGCCTCGGTGGTGACGTCGAGATGCTCAGCACTGACAAGGCGCATAACCCCCTCGTT
TACGCACGCTTCGCGGGCAAGAAGGAGTCTGCTCAGGACCGGAAACGCATTCTCTTCTACGGCCACTACGATGTC
GTCGCTGCAGACACTCGCAAGGGCAAATGGCTGACGGATCCCTTCACGCTCAAGGGAACCAACGGTTTTCTCTAC
GGCCGCGGCGTCAGCGACAACAAAGGCCCCATTGTCGCTGCTGTTTACGCGGTGACGGAACTGATGCAGGCGCAG
AAGCTGGAGAACGATGTCGTTTTCCTCATCGAGGGGGAGGAAGAGTTTGGTTCGAGGGGCTTTGAGGAGGCCGTC
AGGAGGCACAAGCATCTCATCGGCCACGTCGACTACATCCTACTCGCCAATAGCTACTGGCTCGACGACGAGGTT
CCCTGCCTCACGTACGGTCTCCGGGGTGTTCTCCACGCGACTGTCTGCGTCGACGCGCCCCGTCCTGATCTACAC
TCGGGTGTCGACGGCTCCTACTTGGTCAACGAGCCGCTGTCAGACTTGACCAGCATTCTGTCGAGGCTCAAGGGC
GGCGGCAACAGGATACAGATCCCGGGATTCTACGATGGCGTGCCGCCTATGGGACCCGAGGAGGAGGCGAGGTTC
GACGAGATTGCGTCAATGTTAACGCGTCATGGCGCAGACGAGAAGACGACGACCAAGATGACGAGGCAGACGCTC
AAGCAATCGCTTATGGCGCGCTGGCGAGAGCCCAACCTCACCATCCACCGCTACAAGGTGTCGGGCCCGGAGGGC
AGCCTGGTGAGCAGCCACGCGAGCTCGCATATCAGCCTGCGGCTGGTACCAGGGCAGGAGGTCGAGGAAGTGGCC
GAGGCGCTGGCCTGGTTTCTGCGACGCGAGTTCTCGCTGCTCCGGTCGCAGAACCGGCTGACAGTCAATATCGAC
AACAAGGCCGAGCCCTGGCTGGGTGACCCGACCAACGCCATCTTCCGCACGCTGGGACAGGCCATTGTCGAGGCC
TGGCCTGGCTGCTTCGGCCGCGGGGGCGCGAAGCAGGACAGGGACGCTGGAGAGGACGAGGAGGAGGGAAAGACG
AGGAGGGCGGCGGCAGCTGACGAGGAGGCGTCGAAGCCCGTCAAGCCGAAGCAGCCGCTGTATATCCGCGAGGGC
GGCTCCATCCCGGCCATCCGCTTCCTGGAGAAGGAGTTTGGCGCGCCGGCGGCTCATCTGCCGTGTGGGAGGGCC
AGTGACGCGGCCCATTTGGATAATGAGCGGATCTGTATGGTGAATCTTTTCAAGGCCAAGGAGATTTTCGGCAAG
GTGTTTGCGAGATTGTAG
Gene >Ophun1|5921
ATGCCGTCTGTCACCGCCCAGCCAGACCTCACTTCGCCCTCGAGCGAGTCGCCTCATAGCTCTCCGCGGCTCGTT
CACGGCCTCGAGCATGGCAGCTCCGTGCTCGCTCTCGCAGTCAGCCCTGAGCACAATGCCATCTTCGCCGGCACT
CAGGACGGAGAGATTGTCGTCTGGTCGCTGGCCACCTTTCATCAGGTACACCTCGTCCAGGCTCACAAGCGCAGC
GTCCTCTCCCTCTTTCTCTCTCCCGACCGCTCTCTTCTCTTCTCGAGCGCCGGCGATCCAATTGTCAACGTTTGG
TGTCCCAAGACGCTGCGGCGCCTGTACGAGATCTACGGCGTTCACGATGTGGGCGACATCTTCTGCACCGCCTAT
AGCGCCCAGCGAGATGCCCTCTACATAGGCGCTCAGAACACGTCAATCCAATGGGTGGGCTTGGCCGACACCGCC
TCGCGTGTCGCCGCGGGCTCGCAACGGCACCCGGACCGCAGGAGTCATCGCTTCTTCGACTCCAAGGCCATTGGC
GGCTCGAGCACGCCCAGGAGGAACGACGGCCGGTGGAATTTGATCCCGCGCGCTCAGGCTGTTCTCGAGATTGAC
GGAAGCTCTATCCGACGCTTTGCCCACAACGGCTACGTATATTGCATGCTCATGGCCACGGGGCCCACGGTCGAG
GTAGACGCCGACGACGACGTCCTGATATCTGGCGGTGGTGACGGTACAATCAAGCTTTGGACCCTTGGAGGCCGG
CGTCGTTGCCGTGATGAGGGTCGAGACGAGGCCGGCAGTGGCGGGATCGAGGAGCTCATGACGCTGGGCAGCGAT
GATGCCGAATCGGTCTTGTCTCTCGCCCTCGACGGCTCCTTTCTATACGCTGGGAAGCTTGACGGCATCGTCGAG
CTATGGGATCTGGACACCACTCAGAGACTGAGGGTCATCAAGGCGCACGGAGGAAACGTCATGTCGCTGCAGATG
GGATGGGGTCATCTCTGGACAGCATCGACCAACGGCTGTGCGAGTGTGAGTACAAAAGCACAATCATTCATCCCT
GTCATTAAGCCCTGACGCAAAAAAGAGGTACAGCACAGCCCATTACGGTGCCTATAGCCATGCCTCGTCCGGAGA
CGTTAGCCAGAAATACCAATGTCTGAGCAAATGGAACGCCCATGAGGGCAAGATCCTGGCCTCAGCCGTCACCAC
CTACGGCCATCACAAGTACTTCATCACCGGGGCCAACGATCGCAGCATATCCATATGGTCAATCAAGGACAAGGA
CCTGCCGGAGAGGCCGGCGACGGATGGCAACGAGGATCTGCTCATCTCTACTCTCGCCGACTTTGTCTCGTACAA
GACGGTCTCGTCTCGACCGGATCACGCTGAGGACTGCCGTAAGGGCGCTACCTTTCTCGGCGCGCTTCTCAAGCG
CCTCGGTGGTGACGTCGAGATGCTCAGCACTGACAAGGCGCATAACCCCCTCGTTTACGCACGCTTCGCGGGCAA
GAAGGAGTCTGCTCAGGACCGGAAACGCATTCTCTTCTACGGCCACTACGATGTCGTCGCTGCAGACACTCGCAA
GGGCAAATGGCTGACGGATCCCTTCACGCTCAAGGGAACCAACGGTTTTCTCTACGGCCGCGGCGTCAGCGACAA
CAAAGGCCCCATTGTCGCTGCTGTTTACGCGGTGACGGAACTGATGCAGGCGCAGAAGCTGGAGAACGATGTCGT
TTTCCTCATCGAGGGGGAGGAAGAGTTTGGTTCGAGGGGCTTTGAGGAGGCCGTCAGGAGGCACAAGCATCTCAT
CGGCCACGTCGACTACATCCTACTCGCCAATAGCTACTGGCTCGACGACGAGGTTCCCTGCCTCACGTACGGTCT
CCGGGGTGTTCTCCACGCGACTGTCTGCGTCGACGCGCCCCGTCCTGATCTACACTCGGGTGTCGACGGCTCCTA
CTTGGTCAACGAGCCGCTGTCAGACTTGACCAGCATTCTGTCGAGGCTCAAGGGCGGCGGCAACAGGATACAGAT
CCCGGGATTCTACGATGGCGTGCCGCCTATGGGACCCGAGGAGGAGGCGAGGTTCGACGAGATTGCGTCAATGTT
AACGCGTCATGGCGCAGACGAGAAGACGACGACCAAGATGACGAGGCAGACGCTCAAGCAATCGCTTATGGCGCG
CTGGCGAGAGCCCAACCTCACCATCCACCGCTACAAGGTGTCGGGCCCGGAGGGCAGCCTGGTGAGCAGCCACGC
GAGCTCGCATATCAGCCTGCGGCTGGTACCAGGGCAGGAGGTCGAGGAAGTGGCCGAGGCGCTGGCCTGGTTTCT
GCGACGCGAGTTCTCGCTGCTCCGGTCGCAGAACCGGCTGACAGTCAATATCGACAACAAGGCCGAGCCCTGGCT
GGGTGACCCGACCAACGCCATCTTCCGCACGCTGGGACAGGCCATTGTCGAGGCCTGGCCTGGCTGCTTCGGCCG
CGGGGGCGCGAAGCAGGACAGGGACGCTGGAGAGGACGAGGAGGAGGGAAAGACGAGGAGGGCGGCGGCAGCTGA
CGAGGAGGCGTCGAAGCCCGTCAAGCCGAAGCAGCCGCTGTATATCCGCGAGGGCGGCTCCATCCCGGCCATCCG
CTTCCTGGAGAAGGAGTTTGGCGCGCCGGCGGCTCATCTGCCGTGTGGGAGGGCCAGTGACGCGGCCCATTTGGA
TAATGAGCGGATCTGTATGGTGAATCTTTTCAAGGCCAAGGAGATTTTCGGCAAGGTGTTTGCGAGATTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail