Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5920
Gene name
LocationContig_61:38498..41661
Strand+
Gene length (bp)3163
Transcript length (bp)3048
Coding sequence length (bp)3048
Protein length (aa) 1016

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 2.0E-97 321 604
PF02929 Bgal_small_N Beta galactosidase small chain 1.9E-61 742 1013
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 9.1E-39 49 218
PF16353 LacZ_4 Beta-galactosidase, domain 4 8.7E-18 613 706
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 7.8E-10 224 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00723|BGAL_KLULA Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC4 PE=1 SV=2 48 1015 0.0E+00
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 11 1013 0.0E+00
sp|Q56307|BGAL_THEMA Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lacZ PE=3 SV=2 49 988 7.0E-177
sp|O52847|BGAL_BACMD Beta-galactosidase OS=Bacillus megaterium (strain DSM 319) GN=bgaM PE=3 SV=1 9 1008 3.0E-166
sp|Q6LL68|BGAL_PHOPR Beta-galactosidase OS=Photobacterium profundum GN=lacZ PE=3 SV=1 10 1014 4.0E-165
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00723|BGAL_KLULA Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC4 PE=1 SV=2 48 1015 0.0E+00
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 11 1013 0.0E+00
sp|Q56307|BGAL_THEMA Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lacZ PE=3 SV=2 49 988 7.0E-177
sp|O52847|BGAL_BACMD Beta-galactosidase OS=Bacillus megaterium (strain DSM 319) GN=bgaM PE=3 SV=1 9 1008 3.0E-166
sp|Q6LL68|BGAL_PHOPR Beta-galactosidase OS=Photobacterium profundum GN=lacZ PE=3 SV=1 10 1014 4.0E-165
sp|A5F5U6|BGAL_VIBC3 Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lacZ PE=3 SV=2 10 1014 2.0E-162
sp|Q7MG04|BGAL_VIBVY Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) GN=lacZ PE=3 SV=1 10 1012 7.0E-161
sp|Q8D4H3|BGAL_VIBVU Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) GN=lacZ PE=3 SV=2 10 1012 7.0E-161
sp|B4S2K9|BGAL_ALTMD Beta-galactosidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=lacZ PE=3 SV=1 7 988 3.0E-158
sp|P81650|BGAL_PSEHA Beta-galactosidase OS=Pseudoalteromonas haloplanktis GN=lacZ PE=1 SV=2 10 1014 2.0E-154
sp|Q59140|BGAL_ARTSB Beta-galactosidase OS=Arthrobacter sp. (strain B7) GN=lacZ PE=1 SV=1 43 1005 5.0E-153
sp|A0KQH4|BGAL_AERHH Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lacZ PE=3 SV=1 7 988 9.0E-153
sp|Q2XQU3|BGAL2_ENTCL Beta-galactosidase 2 OS=Enterobacter cloacae GN=lacZ PE=3 SV=1 10 1004 3.0E-152
sp|B1LIM9|BGAL_ECOSM Beta-galactosidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lacZ PE=3 SV=1 10 1013 2.0E-150
sp|Q6D736|BGAL_PECAS Beta-galactosidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lacZ PE=3 SV=1 10 988 3.0E-149
sp|A1JTC4|BGAL_YERE8 Beta-galactosidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lacZ PE=3 SV=1 10 988 4.0E-149
sp|Q9K9C6|BGAL_BACHD Beta-galactosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lacZ PE=3 SV=1 13 1010 1.0E-148
sp|A1SWB8|BGAL_PSYIN Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) GN=lacZ PE=3 SV=1 10 1014 3.0E-148
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 10 1010 3.0E-148
sp|A8GGN3|BGAL_SERP5 Beta-galactosidase OS=Serratia proteamaculans (strain 568) GN=lacZ PE=3 SV=1 10 1014 3.0E-147
sp|A9MQ82|BGAL_SALAR Beta-galactosidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lacZ PE=3 SV=2 10 1012 3.0E-147
sp|A7MN76|BGAL_CROS8 Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lacZ PE=3 SV=1 40 1014 9.0E-147
sp|Q32JB6|BGAL_SHIDS Beta-galactosidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lacZ PE=3 SV=2 10 1013 3.0E-146
sp|A7ZI91|BGAL_ECO24 Beta-galactosidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lacZ PE=3 SV=1 10 1013 3.0E-146
sp|A7ZWZ1|BGAL_ECOHS Beta-galactosidase OS=Escherichia coli O9:H4 (strain HS) GN=lacZ PE=3 SV=1 10 1013 3.0E-146
sp|A3FEW8|BGAL_ENTAG Beta-galactosidase OS=Enterobacter agglomerans GN=lacZ PE=1 SV=2 10 1010 9.0E-146
sp|Q3Z583|BGAL_SHISS Beta-galactosidase OS=Shigella sonnei (strain Ss046) GN=lacZ PE=3 SV=1 10 1013 3.0E-145
sp|A6TI29|BGAL2_KLEP7 Beta-galactosidase 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lacZ2 PE=3 SV=1 10 1013 3.0E-145
sp|B7N8Q1|BGAL_ECOLU Beta-galactosidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lacZ PE=3 SV=1 10 1013 3.0E-145
sp|Q47077|BGAL1_ENTCL Beta-galactosidase OS=Enterobacter cloacae GN=lacZ PE=3 SV=1 10 1004 4.0E-145
sp|B2VHN8|BGAL_ERWT9 Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lacZ PE=3 SV=1 7 1014 1.0E-144
sp|P00722|BGAL_ECOLI Beta-galactosidase OS=Escherichia coli (strain K12) GN=lacZ PE=1 SV=2 10 1013 3.0E-144
sp|Q8VNN2|BGAL_ECOLX Beta-galactosidase OS=Escherichia coli GN=lacZ PE=3 SV=1 10 1013 3.0E-144
sp|B7UJI9|BGAL_ECO27 Beta-galactosidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lacZ PE=3 SV=1 10 1013 1.0E-143
sp|A7KGA5|BGAL2_KLEPN Beta-galactosidase OS=Klebsiella pneumoniae GN=lacZ PE=3 SV=1 10 988 1.0E-143
sp|A8AKB8|BGAL_CITK8 Beta-galactosidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lacZ PE=3 SV=1 10 1012 2.0E-143
sp|B1J0T5|BGAL_ECOLC Beta-galactosidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lacZ PE=3 SV=1 10 1013 2.0E-143
sp|Q1RFJ2|BGAL_ECOUT Beta-galactosidase OS=Escherichia coli (strain UTI89 / UPEC) GN=lacZ PE=3 SV=1 10 1013 2.0E-142
sp|B5Z2P7|BGAL_ECO5E Beta-galactosidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lacZ PE=3 SV=1 10 1013 2.0E-142
sp|Q8X685|BGAL_ECO57 Beta-galactosidase OS=Escherichia coli O157:H7 GN=lacZ PE=3 SV=1 10 1013 2.0E-142
sp|Q8FKG6|BGAL_ECOL6 Beta-galactosidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lacZ PE=3 SV=1 10 1013 2.0E-142
sp|A1A831|BGAL_ECOK1 Beta-galactosidase OS=Escherichia coli O1:K1 / APEC GN=lacZ PE=3 SV=1 10 1013 9.0E-142
sp|Q0TKT1|BGAL_ECOL5 Beta-galactosidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lacZ PE=3 SV=1 10 1013 9.0E-142
sp|Q03WL0|BGAL_LEUMM Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lacZ PE=3 SV=1 10 1005 5.0E-141
sp|A4TLL5|BGAL_YERPP Beta-galactosidase OS=Yersinia pestis (strain Pestoides F) GN=lacZ PE=3 SV=1 7 988 4.0E-138
sp|Q1CI76|BGAL_YERPN Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lacZ PE=3 SV=1 7 988 4.0E-138
sp|Q7CIZ3|BGAL_YERPE Beta-galactosidase OS=Yersinia pestis GN=lacZ PE=3 SV=1 7 988 4.0E-138
sp|Q1C6T8|BGAL_YERPA Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lacZ PE=3 SV=1 7 988 4.0E-138
sp|A9R0J8|BGAL_YERPG Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lacZ PE=3 SV=1 7 988 5.0E-138
sp|Q669R9|BGAL_YERPS Beta-galactosidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lacZ PE=3 SV=1 7 988 5.0E-137
sp|B2K6E6|BGAL_YERPB Beta-galactosidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lacZ PE=3 SV=1 7 988 5.0E-137
sp|B1JI86|BGAL_YERPY Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lacZ PE=3 SV=1 7 988 5.0E-137
sp|A7FH78|BGAL_YERP3 Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lacZ PE=3 SV=1 7 988 6.0E-137
sp|B5XQY2|BGAL_KLEP3 Beta-galactosidase OS=Klebsiella pneumoniae (strain 342) GN=lacZ PE=3 SV=1 1 1010 1.0E-136
sp|A6T8X0|BGAL1_KLEP7 Beta-galactosidase 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lacZ1 PE=3 SV=1 7 1014 1.0E-134
sp|P06219|BGAL1_KLEPN Beta-galactosidase OS=Klebsiella pneumoniae GN=lacZ PE=3 SV=1 78 1014 1.0E-133
sp|O33815|BGAL_STAXY Beta-galactosidase OS=Staphylococcus xylosus GN=lacZ PE=3 SV=1 13 1014 3.0E-133
sp|P70753|BGAL_ACTPL Beta-galactosidase OS=Actinobacillus pleuropneumoniae GN=lacZ PE=3 SV=1 1 1015 2.0E-131
sp|P23989|BGAL_STRTR Beta-galactosidase OS=Streptococcus thermophilus GN=lacZ PE=3 SV=1 48 1015 3.0E-131
sp|P24131|BGAL_CLOAT Beta-galactosidase OS=Clostridium acetobutylicum GN=cbgA PE=2 SV=2 1 903 8.0E-131
sp|Q04F24|BGAL_OENOB Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=lacZ PE=3 SV=1 33 1011 9.0E-126
sp|Q48727|BGAL_LACLA Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacZ PE=3 SV=3 46 1012 2.0E-125
sp|Q1G9Z4|BGAL_LACDA Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lacZ PE=3 SV=3 48 968 3.0E-121
sp|P0C1Y0|BGAL_LACDE Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=lacZ PE=1 SV=2 48 968 2.0E-120
sp|Q02603|BGAL_LEULA Beta-galactosidase large subunit OS=Leuconostoc lactis GN=lacL PE=1 SV=1 48 595 2.0E-99
sp|Q48846|BGAL_LACSK Beta-galactosidase large subunit OS=Lactobacillus sakei GN=lacL PE=3 SV=1 48 595 8.0E-97
sp|Q7WTB4|BGAL_LACHE Beta-galactosidase large subunit OS=Lactobacillus helveticus GN=lacL PE=2 SV=1 48 595 1.0E-91
sp|O07684|BGAL_LACAC Beta-galactosidase large subunit OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=lacL PE=3 SV=2 48 595 6.0E-88
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 123 486 2.0E-30
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 50 450 3.0E-26
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 123 448 8.0E-24
sp|P26257|BGAL_THETU Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes GN=lacZ PE=1 SV=1 97 469 3.0E-21
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 140 485 5.0E-21
sp|P12265|BGLR_MOUSE Beta-glucuronidase OS=Mus musculus GN=Gusb PE=1 SV=2 140 485 9.0E-21
sp|P08236|BGLR_HUMAN Beta-glucuronidase OS=Homo sapiens GN=GUSB PE=1 SV=2 135 477 4.0E-20
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 151 539 5.0E-20
sp|O77695|BGLR_CHLAE Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops GN=GUSB PE=2 SV=1 140 485 1.0E-19
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 140 477 9.0E-19
sp|Q5R5N6|BGLR_PONAB Beta-glucuronidase OS=Pongo abelii GN=GUSB PE=2 SV=2 140 448 9.0E-19
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 151 485 2.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004565 beta-galactosidase activity Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0009341 beta-galactosidase complex Yes
GO:0032991 protein-containing complex No
GO:0015925 galactosidase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0005575 cellular_component No
GO:1902494 catalytic complex No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH2 1.9E-210 40 897

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6231
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01303
Ophiocordyceps camponoti-rufipedis Ophun1|5920 (this protein)
Ophiocordyceps kimflemingae Ophio5|6512
Ophiocordyceps subramaniannii Hirsu2|7136

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5920
MPNFPPSQPDWSNIHVIHRKTLLPRSHFFLYDNQTDALSRDVSRAKAQCLSGTWKFHLSRSPFDGPRLFHKPGFA
ATDFSDITVPGMWQLQGHGKGPHYTNVIYPWPVDPPNISYQDNECGRYLTTFVVRDSFARHQLRLRFEGVDAAFS
VWINGRDVGYSQGSRNPSEFDVTDLVEMGQSNTLAVEVYQRCDGSYIEDQDQWWLSGIFRDVYLHAFPSLHPVDF
HVVTCLDDEFRNAVLKVKVETSKASAVSLKLLDADENEVVSETKDIDGLAMFELDVDEPLKWTAETPNLYTLVLT
FGKDVCCLAQHIGFRTAGLIDGVFCVNGSPVKLRGVNRHEHHPDHGRAVPYDFMRRDLMLMKKCNVNAIRTSHQI
NDPRLYDVADELGLWVLDEADLECHGFENVGRDPASYTSDNPDWCEQYVDRARQMVARDKNHASIILWSLGNEAF
YGRNHQAMYDCIKSIDDTRLVHYEGDSQAKTADIFSRMYPTIDSVVNDFAKAREWKKPLVLCEFLHAMGNSVGNA
KEYIDLFYKHPRLMGGFVWEWANHGLRTRTKDGIEYMGYGGDFGDEPNDYNFIMDGLLWSEHCLTPNMAEYAKSI
EPVQTVARHHHQVTVVNRYDFLSLDHLAASWTIVTEAKGITYAGSVTIPSGVKPHGEASVELDDFHESMLLEAVG
GESFLQLFFKLKHSTSWAPENHVVATGELRVSKPLSLAGLRGLEPPMPRPRADQTEDGLLTITSASESSTWVMNL
VTGMLTSWKRGGQAEMLTEPIRMDLYRALTDNDRSGHGRQWFERRLHQMTSQVRMVKWHASTDGLHVEVTERMAP
PALGWGIENAWTYSFRGDSVCIQVQVKPCGPGLPETLARIGLTLGLGGADRVRWWGRGPGESYRDKKRSQLLGEW
EATIDDLWVDYEFPQDGGNRTDVRTVELVGSGGERKLRARFGDLEGASFSAARYSTADVDSSKHPFELRAKRRED
VVVKLDWAHHGLGTASCGPWTLPRYQLRSDREYEFEILLD*
Coding >Ophun1|5920
ATGCCCAACTTCCCCCCTTCTCAGCCCGACTGGAGCAATATCCACGTTATTCACCGCAAAACCCTCCTGCCACGC
AGCCACTTCTTCCTCTACGACAACCAGACCGACGCCCTCTCACGAGACGTCAGCAGGGCCAAGGCCCAGTGCCTC
TCCGGGACATGGAAGTTCCATTTGTCCCGGTCGCCCTTCGACGGCCCTCGCCTCTTTCACAAGCCGGGCTTCGCC
GCCACCGACTTCTCGGACATCACCGTCCCCGGCATGTGGCAGCTCCAGGGCCATGGCAAAGGCCCGCACTACACA
AACGTTATCTACCCCTGGCCCGTTGATCCGCCCAACATCTCGTATCAAGACAACGAGTGCGGCAGGTATCTCACG
ACGTTTGTGGTCCGTGACAGCTTCGCCCGCCACCAGCTCAGGCTACGTTTCGAAGGCGTCGACGCGGCCTTTTCC
GTATGGATCAACGGCCGAGACGTCGGCTACTCACAGGGATCCAGAAACCCTAGTGAGTTTGACGTGACGGATCTG
GTCGAGATGGGACAGTCCAACACGCTGGCCGTCGAGGTCTATCAGCGCTGTGACGGCAGCTACATAGAGGACCAG
GACCAGTGGTGGCTCAGCGGCATCTTCCGTGATGTGTACTTGCACGCCTTCCCGTCGCTTCACCCTGTCGACTTT
CACGTCGTCACTTGTCTGGACGATGAGTTTAGAAATGCCGTGTTAAAGGTCAAGGTCGAGACGAGCAAGGCGTCG
GCCGTCAGCTTGAAGCTACTCGACGCTGACGAGAACGAGGTCGTCAGCGAAACCAAGGACATTGACGGCTTAGCC
ATGTTTGAGCTTGACGTCGATGAACCGCTCAAGTGGACAGCCGAGACGCCCAACTTGTACACACTCGTCCTCACG
TTTGGAAAAGATGTCTGCTGCCTGGCGCAGCACATCGGCTTCCGCACTGCCGGCCTCATCGACGGCGTCTTCTGC
GTCAATGGGAGTCCCGTGAAGCTCCGTGGCGTCAACCGTCACGAGCATCATCCCGACCATGGCAGGGCCGTTCCG
TACGACTTTATGCGGCGAGACTTGATGCTCATGAAAAAGTGCAACGTCAACGCCATCCGCACCTCTCACCAGATC
AACGACCCGCGCTTGTACGACGTCGCCGACGAGCTCGGTCTATGGGTTCTGGACGAGGCCGATCTAGAGTGTCAT
GGCTTCGAGAACGTCGGACGCGACCCGGCGTCGTACACGTCTGATAACCCGGACTGGTGCGAGCAATACGTCGAC
AGAGCACGCCAGATGGTTGCTCGTGACAAGAATCACGCGTCCATCATTCTATGGTCGCTGGGAAACGAGGCCTTT
TACGGCCGGAATCATCAGGCCATGTACGACTGCATAAAGTCCATCGACGACACGAGGCTGGTGCATTACGAGGGT
GACAGCCAGGCCAAGACGGCCGACATCTTTAGCCGAATGTATCCCACTATTGACAGCGTCGTCAACGATTTTGCC
AAGGCGAGAGAGTGGAAGAAGCCCCTTGTTCTTTGCGAGTTTCTGCACGCCATGGGAAACTCGGTCGGCAACGCC
AAAGAGTACATCGACCTCTTTTACAAGCACCCGCGACTCATGGGCGGCTTCGTCTGGGAATGGGCGAACCATGGC
TTGCGGACACGGACCAAAGACGGCATCGAGTACATGGGCTATGGGGGCGACTTTGGTGACGAGCCCAACGACTAC
AACTTCATCATGGACGGACTCCTCTGGTCTGAGCACTGTCTAACCCCCAACATGGCTGAGTATGCCAAGTCTATC
GAGCCGGTGCAGACGGTGGCACGACATCATCACCAGGTTACCGTCGTGAACCGCTACGACTTCCTCAGTCTCGAC
CACCTAGCAGCCTCGTGGACCATTGTGACGGAAGCCAAAGGCATTACATATGCCGGAAGCGTAACCATTCCGAGC
GGAGTCAAGCCGCATGGCGAGGCCAGCGTTGAGCTCGACGACTTTCACGAGAGCATGCTGCTAGAGGCGGTGGGT
GGCGAATCTTTTCTTCAGCTCTTCTTCAAGTTGAAACACTCGACAAGCTGGGCTCCAGAGAACCACGTCGTCGCC
ACAGGAGAACTACGAGTCTCGAAGCCGCTGTCTCTGGCTGGGCTCCGGGGTTTGGAGCCCCCAATGCCTCGGCCA
AGGGCAGACCAGACAGAAGACGGACTTCTCACCATCACCTCGGCCTCGGAAAGCTCGACGTGGGTTATGAACCTG
GTGACGGGCATGCTGACGAGCTGGAAGAGAGGGGGTCAGGCGGAGATGCTCACGGAACCGATCCGGATGGACTTG
TACCGCGCCCTGACAGACAATGACAGGTCCGGACACGGCAGACAGTGGTTCGAACGGCGTCTCCATCAGATGACT
AGCCAGGTGCGCATGGTAAAGTGGCACGCCTCCACGGACGGGCTGCATGTCGAGGTTACGGAGAGGATGGCACCC
CCGGCGCTGGGCTGGGGGATCGAGAACGCATGGACATATAGCTTTCGAGGCGATTCAGTCTGCATTCAGGTGCAA
GTGAAGCCGTGCGGACCGGGTCTTCCGGAGACGCTGGCCCGCATCGGCCTGACGCTTGGCCTCGGCGGCGCGGAC
CGGGTCCGGTGGTGGGGCCGGGGTCCGGGGGAATCGTACCGGGACAAGAAGCGATCACAGCTCTTGGGCGAATGG
GAAGCGACAATAGATGACCTCTGGGTCGACTACGAGTTTCCTCAGGACGGTGGAAACCGGACAGATGTCCGGACG
GTCGAGCTGGTCGGTTCCGGAGGGGAGCGGAAGCTGAGGGCTCGCTTCGGCGACCTCGAGGGCGCGAGCTTCTCA
GCCGCGCGATACTCGACGGCGGATGTGGATTCCAGTAAGCATCCGTTTGAGCTGAGAGCAAAGAGGAGGGAAGAC
GTGGTTGTCAAGCTGGACTGGGCGCATCATGGGCTGGGGACGGCTTCATGTGGACCATGGACGCTGCCGCGATAT
CAGCTGAGGAGCGACAGGGAGTATGAGTTTGAGATTTTGCTGGACTAG
Transcript >Ophun1|5920
ATGCCCAACTTCCCCCCTTCTCAGCCCGACTGGAGCAATATCCACGTTATTCACCGCAAAACCCTCCTGCCACGC
AGCCACTTCTTCCTCTACGACAACCAGACCGACGCCCTCTCACGAGACGTCAGCAGGGCCAAGGCCCAGTGCCTC
TCCGGGACATGGAAGTTCCATTTGTCCCGGTCGCCCTTCGACGGCCCTCGCCTCTTTCACAAGCCGGGCTTCGCC
GCCACCGACTTCTCGGACATCACCGTCCCCGGCATGTGGCAGCTCCAGGGCCATGGCAAAGGCCCGCACTACACA
AACGTTATCTACCCCTGGCCCGTTGATCCGCCCAACATCTCGTATCAAGACAACGAGTGCGGCAGGTATCTCACG
ACGTTTGTGGTCCGTGACAGCTTCGCCCGCCACCAGCTCAGGCTACGTTTCGAAGGCGTCGACGCGGCCTTTTCC
GTATGGATCAACGGCCGAGACGTCGGCTACTCACAGGGATCCAGAAACCCTAGTGAGTTTGACGTGACGGATCTG
GTCGAGATGGGACAGTCCAACACGCTGGCCGTCGAGGTCTATCAGCGCTGTGACGGCAGCTACATAGAGGACCAG
GACCAGTGGTGGCTCAGCGGCATCTTCCGTGATGTGTACTTGCACGCCTTCCCGTCGCTTCACCCTGTCGACTTT
CACGTCGTCACTTGTCTGGACGATGAGTTTAGAAATGCCGTGTTAAAGGTCAAGGTCGAGACGAGCAAGGCGTCG
GCCGTCAGCTTGAAGCTACTCGACGCTGACGAGAACGAGGTCGTCAGCGAAACCAAGGACATTGACGGCTTAGCC
ATGTTTGAGCTTGACGTCGATGAACCGCTCAAGTGGACAGCCGAGACGCCCAACTTGTACACACTCGTCCTCACG
TTTGGAAAAGATGTCTGCTGCCTGGCGCAGCACATCGGCTTCCGCACTGCCGGCCTCATCGACGGCGTCTTCTGC
GTCAATGGGAGTCCCGTGAAGCTCCGTGGCGTCAACCGTCACGAGCATCATCCCGACCATGGCAGGGCCGTTCCG
TACGACTTTATGCGGCGAGACTTGATGCTCATGAAAAAGTGCAACGTCAACGCCATCCGCACCTCTCACCAGATC
AACGACCCGCGCTTGTACGACGTCGCCGACGAGCTCGGTCTATGGGTTCTGGACGAGGCCGATCTAGAGTGTCAT
GGCTTCGAGAACGTCGGACGCGACCCGGCGTCGTACACGTCTGATAACCCGGACTGGTGCGAGCAATACGTCGAC
AGAGCACGCCAGATGGTTGCTCGTGACAAGAATCACGCGTCCATCATTCTATGGTCGCTGGGAAACGAGGCCTTT
TACGGCCGGAATCATCAGGCCATGTACGACTGCATAAAGTCCATCGACGACACGAGGCTGGTGCATTACGAGGGT
GACAGCCAGGCCAAGACGGCCGACATCTTTAGCCGAATGTATCCCACTATTGACAGCGTCGTCAACGATTTTGCC
AAGGCGAGAGAGTGGAAGAAGCCCCTTGTTCTTTGCGAGTTTCTGCACGCCATGGGAAACTCGGTCGGCAACGCC
AAAGAGTACATCGACCTCTTTTACAAGCACCCGCGACTCATGGGCGGCTTCGTCTGGGAATGGGCGAACCATGGC
TTGCGGACACGGACCAAAGACGGCATCGAGTACATGGGCTATGGGGGCGACTTTGGTGACGAGCCCAACGACTAC
AACTTCATCATGGACGGACTCCTCTGGTCTGAGCACTGTCTAACCCCCAACATGGCTGAGTATGCCAAGTCTATC
GAGCCGGTGCAGACGGTGGCACGACATCATCACCAGGTTACCGTCGTGAACCGCTACGACTTCCTCAGTCTCGAC
CACCTAGCAGCCTCGTGGACCATTGTGACGGAAGCCAAAGGCATTACATATGCCGGAAGCGTAACCATTCCGAGC
GGAGTCAAGCCGCATGGCGAGGCCAGCGTTGAGCTCGACGACTTTCACGAGAGCATGCTGCTAGAGGCGGTGGGT
GGCGAATCTTTTCTTCAGCTCTTCTTCAAGTTGAAACACTCGACAAGCTGGGCTCCAGAGAACCACGTCGTCGCC
ACAGGAGAACTACGAGTCTCGAAGCCGCTGTCTCTGGCTGGGCTCCGGGGTTTGGAGCCCCCAATGCCTCGGCCA
AGGGCAGACCAGACAGAAGACGGACTTCTCACCATCACCTCGGCCTCGGAAAGCTCGACGTGGGTTATGAACCTG
GTGACGGGCATGCTGACGAGCTGGAAGAGAGGGGGTCAGGCGGAGATGCTCACGGAACCGATCCGGATGGACTTG
TACCGCGCCCTGACAGACAATGACAGGTCCGGACACGGCAGACAGTGGTTCGAACGGCGTCTCCATCAGATGACT
AGCCAGGTGCGCATGGTAAAGTGGCACGCCTCCACGGACGGGCTGCATGTCGAGGTTACGGAGAGGATGGCACCC
CCGGCGCTGGGCTGGGGGATCGAGAACGCATGGACATATAGCTTTCGAGGCGATTCAGTCTGCATTCAGGTGCAA
GTGAAGCCGTGCGGACCGGGTCTTCCGGAGACGCTGGCCCGCATCGGCCTGACGCTTGGCCTCGGCGGCGCGGAC
CGGGTCCGGTGGTGGGGCCGGGGTCCGGGGGAATCGTACCGGGACAAGAAGCGATCACAGCTCTTGGGCGAATGG
GAAGCGACAATAGATGACCTCTGGGTCGACTACGAGTTTCCTCAGGACGGTGGAAACCGGACAGATGTCCGGACG
GTCGAGCTGGTCGGTTCCGGAGGGGAGCGGAAGCTGAGGGCTCGCTTCGGCGACCTCGAGGGCGCGAGCTTCTCA
GCCGCGCGATACTCGACGGCGGATGTGGATTCCAGTAAGCATCCGTTTGAGCTGAGAGCAAAGAGGAGGGAAGAC
GTGGTTGTCAAGCTGGACTGGGCGCATCATGGGCTGGGGACGGCTTCATGTGGACCATGGACGCTGCCGCGATAT
CAGCTGAGGAGCGACAGGGAGTATGAGTTTGAGATTTTGCTGGACTAG
Gene >Ophun1|5920
ATGCCCAACTTCCCCCCTTCTCAGCCCGACTGGAGCAATATCCACGTTATTCACCGCAAAACCCTCCTGCCACGC
AGCCACTTCTTCCTCTACGACAACCAGACCGACGCCCTCTCACGAGACGTCAGCAGGGCCAAGGCCCAGTGCCTC
TCCGGGACATGGAAGTTCCATTTGTCCCGGTCGCCCTTCGACGGCCCTCGCCTCTTTCACAAGCCGGGCTTCGCC
GCCACCGACTTCTCGGACATCACCGTCCCCGGCATGTGGCAGCTCCAGGGCCATGGCAAAGGCCCGCACTACACA
AACGTTATCTACCCCTGGCCCGTTGATCCGCCCAACATCTCGTATCAAGACAACGAGTGCGGCAGGTATCTCACG
ACGTTTGTGGTCCGTGACAGCTTCGCCCGCCACCAGCTCAGGCTACGTTTCGAAGGCGTCGACGCGGCCTTTTCC
GTATGGATCAACGGCCGAGACGTCGGCTACTCACAGGGATCCAGAAACCCTAGTGAGTTTGACGTGACGGATCTG
GTCGAGATGGGACAGTCCAACACGCTGGCCGTCGAGGTCTATCAGCGCTGTGACGGCAGCTACATAGAGGACCAG
GACCAGTGGTGGCTCAGCGGCATCTTCCGTGATGTGTACTTGCACGCCTTCCCGTCGCTTCACCCTGTCGACTTT
CACGTCGTCACTTGTCTGGACGATGAGTTTAGAAATGCCGTGTTAAAGGTCAAGGTCGAGACGAGCAAGGCGTCG
GCCGTCAGCTTGAAGCTACTCGACGCTGACGAGAACGAGGTCGTCAGCGAAACCAAGGACATTGACGGCTTAGCC
ATGTTTGAGCTTGACGTCGATGAACCGCTCAAGTGGACAGCCGAGACGCCCAACTTGTACACACTCGTCCTCACG
TTTGGAAAAGATGTCTGCTGCCTGGCGCAGCACATCGGCTTCCGCACTGCCGGCCTCATCGACGGCGTCTTCTGC
GTCAATGGGAGTCCCGTGAAGCTCCGTGGCGTCAACCGTCACGAGCATCATCCCGACCATGGCAGGGCCGTTCCG
TACGACTTTATGCGGCGAGACTTGATGCTCATGAAAAAGTGCAACGTCAACGCCATCCGCACCTCTCACCAGATC
AACGACCCGCGCTTGTACGACGTCGCCGACGAGCTCGGTCTATGGGTTCTGGACGAGGCCGATCTAGAGTGTCAT
GGCTTCGAGAACGTCGGACGCGACCCGGCGTCGTACACGTCTGATAACCCGGACTGGTGCGAGCAATACGTCGAC
AGAGCACGCCAGATGGTTGCTCGTGACAAGAATCACGCGTCCATCATTCTATGGTCGCTGGGAAACGAGGCCTTT
TACGGCCGGAATCATCAGGCCATGTACGACTGCATAAAGTCCATCGACGACACGAGGCTGGTGCATTACGAGGGT
GACAGCCAGGCCAAGACGGCCGACATCTTTAGCCGAATGTATCCCACTATTGACAGCGTCGTCAACGATTTTGCC
AAGGCGAGAGAGTGGAAGAAGCCCCTTGTTCTTTGCGAGTTTCTGCACGCCATGGGAAACTCGGTCGGCAACGCC
AAAGAGTACATCGACCTCTTTTACAAGCACCCGCGACTCATGGGCGGCTTCGTCTGGGAATGGGCGAACCATGTA
AGCTCCTTTGAATACAGGGTCGCCGTATGGACGGGCTGATGAGCACAGGGCTTGCGGACACGGACCAAAGACGGC
ATCGAGTACATGGGCTATGGGGGCGACTTTGGTGACGAGCCCAACGACTACAACTTCATCATGGACGGACTCCTC
TGGTCTGAGCACTGTCTAACCCCCAACATGGCTGAGTATGCCAAGTCTATCGAGCCGGTGCAGACGGTGGCACGA
CATCATCACCAGGTTACCGTCGTGAACCGCTACGACTTCCTCAGTCTCGACCACCTAGCAGCCTCGTGGACCATT
GTGACGGAAGCCAAAGGCATTACATATGCCGGAAGCGTAACCATTCCGAGCGGTGCGTTGACGCCTGAGGTCTTA
CCAAGTCGGTTGGTGATGTTATCACTGACGGCCACATTCAGGAGTCAAGCCGCATGGCGAGGCCAGCGTTGAGCT
CGACGACTTTCACGAGAGCATGCTGCTAGAGGCGGTGGGTGGCGAATCTTTTCTTCAGCTCTTCTTCAAGTTGAA
ACACTCGACAAGCTGGGCTCCAGAGAACCACGTCGTCGCCACAGGAGAACTACGAGTCTCGAAGCCGCTGTCTCT
GGCTGGGCTCCGGGGTTTGGAGCCCCCAATGCCTCGGCCAAGGGCAGACCAGACAGAAGACGGACTTCTCACCAT
CACCTCGGCCTCGGAAAGCTCGACGTGGGTTATGAACCTGGTGACGGGCATGCTGACGAGCTGGAAGAGAGGGGG
TCAGGCGGAGATGCTCACGGAACCGATCCGGATGGACTTGTACCGCGCCCTGACAGACAATGACAGGTCCGGACA
CGGCAGACAGTGGTTCGAACGGCGTCTCCATCAGATGACTAGCCAGGTGCGCATGGTAAAGTGGCACGCCTCCAC
GGACGGGCTGCATGTCGAGGTTACGGAGAGGATGGCACCCCCGGCGCTGGGCTGGGGGATCGAGAACGCATGGAC
ATATAGCTTTCGAGGCGATTCAGTCTGCATTCAGGTGCAAGTGAAGCCGTGCGGACCGGGTCTTCCGGAGACGCT
GGCCCGCATCGGCCTGACGCTTGGCCTCGGCGGCGCGGACCGGGTCCGGTGGTGGGGCCGGGGTCCGGGGGAATC
GTACCGGGACAAGAAGCGATCACAGCTCTTGGGCGAATGGGAAGCGACAATAGATGACCTCTGGGTCGACTACGA
GTTTCCTCAGGACGGTGGAAACCGGACAGATGTCCGGACGGTCGAGCTGGTCGGTTCCGGAGGGGAGCGGAAGCT
GAGGGCTCGCTTCGGCGACCTCGAGGGCGCGAGCTTCTCAGCCGCGCGATACTCGACGGCGGATGTGGATTCCAG
TAAGCATCCGTTTGAGCTGAGAGCAAAGAGGAGGGAAGACGTGGTTGTCAAGCTGGACTGGGCGCATCATGGGCT
GGGGACGGCTTCATGTGGACCATGGACGCTGCCGCGATATCAGCTGAGGAGCGACAGGGAGTATGAGTTTGAGAT
TTTGCTGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail