Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|591
Gene name
LocationContig_1186:139..3006
Strand+
Gene length (bp)2867
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.2E-16 165 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 105 319 7.0E-23
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 189 315 7.0E-20
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 141 315 1.0E-13
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 141 335 2.0E-08
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 312 476 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 105 319 7.0E-23
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 189 315 7.0E-20
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 141 315 1.0E-13
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 141 335 2.0E-08
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 312 476 4.0E-07
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 334 475 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 191 213 22
3 225 247 22
4 251 273 22
5 280 302 22
6 330 352 22
7 357 379 22
8 384 406 22
9 419 441 22
10 461 480 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|591
MVMAMTCAAEGEDEVEEEDDDDDDDDWGEMVSAPTLPVLGTNSQTKPVSKGVTSIMLPSSRPLTPQESQSDEDDE
VIQRILSEIPDLSYMLRQSMDRIRNEKGQLHTRSSGQGIETETVGEADGDVEGRCTTDFDFKRLGWQRPPEFKNA
WVEACFVLSSVGALAMADFIVDGFQVLLPALIDPLSIPPGAQIWPSSVVTMVAGSCLFPLGRLTDMYGGYLIFNG
GLTWFTLWTLAAGFATNFIFLVFCRAMQGLGMAAFLPAGIALLGRFYRPGPRKNLVFALYGAACPVGFFSGVLTA
GFSQEVLGQWRWFFWVGGMQMVLKVSSLTTALWYAPWAVSGLIFSTLGGLVLDRIPASWLLIPSSISAIMAVLLF
AVMPSEPSYWLWIFPAMIFEAASADILWTVSNVFLTTSLPRHHQGLAGAIISLTLFVGDALFLAVGDVVEESMAG
AGSGAETQYKAVFWVAVVIGLAALGTNFFIRIPEASAELTVDERDELEWKRGKEDSMTDAETVVGCEMENLLKGS
CGEEGEELE*
Coding >Ophun1|591
ATGGTGATGGCGATGACGTGTGCCGCAGAGGGTGAGGATGAGGTGGAAGAAGAGGACGACGACGATGACGACGAC
GACTGGGGGGAAATGGTCTCGGCGCCGACGCTGCCCGTTCTCGGTACCAACTCGCAGACGAAGCCCGTTTCGAAG
GGAGTGACGAGCATCATGCTTCCGTCTAGTCGGCCTCTTACGCCACAAGAATCTCAGTCAGACGAGGACGACGAG
GTGATCCAGCGGATTCTAAGCGAGATTCCGGACCTGTCATATATGCTGCGGCAGAGCATGGACCGCATACGCAAT
GAGAAGGGGCAGCTTCATACACGGTCATCCGGACAGGGCATCGAGACGGAGACGGTTGGCGAGGCTGACGGCGAT
GTCGAAGGCAGGTGTACGACCGACTTTGACTTTAAGAGGCTGGGGTGGCAGCGGCCGCCCGAGTTTAAGAATGCT
TGGGTTGAGGCCTGCTTTGTGCTGTCCTCGGTAGGGGCCTTGGCCATGGCTGACTTCATCGTCGACGGCTTCCAA
GTCCTGCTCCCCGCCCTCATCGACCCCCTTTCCATCCCCCCCGGCGCGCAGATCTGGCCGTCGAGCGTTGTGACC
ATGGTTGCAGGCTCGTGTCTCTTCCCGCTGGGACGACTGACGGACATGTACGGCGGCTACCTCATCTTCAACGGC
GGGTTAACCTGGTTCACGCTGTGGACGCTGGCAGCGGGATTCGCCACCAACTTCATCTTCCTCGTCTTCTGCCGC
GCCATGCAGGGCTTGGGCATGGCTGCTTTCCTGCCCGCTGGGATAGCCCTCCTCGGCCGCTTCTACCGGCCCGGT
CCGCGCAAGAACCTCGTCTTCGCCCTGTACGGCGCTGCCTGTCCGGTGGGCTTCTTCAGCGGGGTGCTGACGGCG
GGATTCTCGCAGGAGGTGTTGGGGCAGTGGCGGTGGTTCTTCTGGGTTGGCGGCATGCAGATGGTGCTCAAGGTC
TCGTCGCTGACGACGGCTCTTTGGTACGCCCCCTGGGCTGTTAGTGGCCTCATCTTTTCCACGCTGGGAGGTCTT
GTTCTGGATAGGATCCCAGCGTCTTGGCTGCTCATCCCGTCGAGCATCTCGGCCATCATGGCAGTTCTACTCTTC
GCCGTCATGCCTTCCGAACCCAGCTACTGGCTCTGGATCTTCCCAGCCATGATCTTCGAGGCGGCCTCGGCTGAT
ATTCTATGGACGGTGAGCAACGTCTTCCTGACGACCAGCCTCCCGCGCCACCACCAGGGTCTCGCCGGCGCCATC
ATCAGCCTGACGCTCTTCGTGGGCGACGCCCTCTTCCTGGCCGTGGGCGACGTGGTGGAAGAGTCGATGGCTGGA
GCCGGGTCAGGGGCTGAGACGCAGTACAAGGCTGTGTTTTGGGTGGCTGTTGTGATTGGCTTGGCGGCCTTGGGC
ACCAATTTCTTTATTCGGATTCCGGAGGCGTCGGCTGAGTTGACGGTGGATGAGAGGGATGAGTTGGAGTGGAAG
CGGGGGAAGGAGGATTCTATGACGGATGCTGAGACGGTGGTTGGGTGTGAGATGGAGAATTTGTTGAAGGGATCG
TGCGGTGAGGAGGGGGAGGAGTTGGAGTAA
Transcript >Ophun1|591
ATGGTGATGGCGATGACGTGTGCCGCAGAGGGTGAGGATGAGGTGGAAGAAGAGGACGACGACGATGACGACGAC
GACTGGGGGGAAATGGTCTCGGCGCCGACGCTGCCCGTTCTCGGTACCAACTCGCAGACGAAGCCCGTTTCGAAG
GGAGTGACGAGCATCATGCTTCCGTCTAGTCGGCCTCTTACGCCACAAGAATCTCAGTCAGACGAGGACGACGAG
GTGATCCAGCGGATTCTAAGCGAGATTCCGGACCTGTCATATATGCTGCGGCAGAGCATGGACCGCATACGCAAT
GAGAAGGGGCAGCTTCATACACGGTCATCCGGACAGGGCATCGAGACGGAGACGGTTGGCGAGGCTGACGGCGAT
GTCGAAGGCAGGTGTACGACCGACTTTGACTTTAAGAGGCTGGGGTGGCAGCGGCCGCCCGAGTTTAAGAATGCT
TGGGTTGAGGCCTGCTTTGTGCTGTCCTCGGTAGGGGCCTTGGCCATGGCTGACTTCATCGTCGACGGCTTCCAA
GTCCTGCTCCCCGCCCTCATCGACCCCCTTTCCATCCCCCCCGGCGCGCAGATCTGGCCGTCGAGCGTTGTGACC
ATGGTTGCAGGCTCGTGTCTCTTCCCGCTGGGACGACTGACGGACATGTACGGCGGCTACCTCATCTTCAACGGC
GGGTTAACCTGGTTCACGCTGTGGACGCTGGCAGCGGGATTCGCCACCAACTTCATCTTCCTCGTCTTCTGCCGC
GCCATGCAGGGCTTGGGCATGGCTGCTTTCCTGCCCGCTGGGATAGCCCTCCTCGGCCGCTTCTACCGGCCCGGT
CCGCGCAAGAACCTCGTCTTCGCCCTGTACGGCGCTGCCTGTCCGGTGGGCTTCTTCAGCGGGGTGCTGACGGCG
GGATTCTCGCAGGAGGTGTTGGGGCAGTGGCGGTGGTTCTTCTGGGTTGGCGGCATGCAGATGGTGCTCAAGGTC
TCGTCGCTGACGACGGCTCTTTGGTACGCCCCCTGGGCTGTTAGTGGCCTCATCTTTTCCACGCTGGGAGGTCTT
GTTCTGGATAGGATCCCAGCGTCTTGGCTGCTCATCCCGTCGAGCATCTCGGCCATCATGGCAGTTCTACTCTTC
GCCGTCATGCCTTCCGAACCCAGCTACTGGCTCTGGATCTTCCCAGCCATGATCTTCGAGGCGGCCTCGGCTGAT
ATTCTATGGACGGTGAGCAACGTCTTCCTGACGACCAGCCTCCCGCGCCACCACCAGGGTCTCGCCGGCGCCATC
ATCAGCCTGACGCTCTTCGTGGGCGACGCCCTCTTCCTGGCCGTGGGCGACGTGGTGGAAGAGTCGATGGCTGGA
GCCGGGTCAGGGGCTGAGACGCAGTACAAGGCTGTGTTTTGGGTGGCTGTTGTGATTGGCTTGGCGGCCTTGGGC
ACCAATTTCTTTATTCGGATTCCGGAGGCGTCGGCTGAGTTGACGGTGGATGAGAGGGATGAGTTGGAGTGGAAG
CGGGGGAAGGAGGATTCTATGACGGATGCTGAGACGGTGGTTGGGTGTGAGATGGAGAATTTGTTGAAGGGATCG
TGCGGTGAGGAGGGGGAGGAGTTGGAGTAA
Gene >Ophun1|591
ATGGTGATGGCGATGACGTGTGCCGCAGAGGGTGAGGATGAGGTGGAAGAAGAGGACGACGACGATGACGACGAC
GACTGGGGGGAAATGGTCTCGGCGCCGACGCTGCCCGTTCTCGGTACCAACTCGCAGACGAAGCCCGTTTCGAAG
GGAGTGACGAGCATCATGCTTCCGTCTAGTCGGCCTCTTACGCCACAAGAATCTCAGTCAGACGAGGACGACGAG
GTGATCCAGCGGATTCTAAGCGAGATTCCGGACCTGTCATATATGCTGCGGTAGGATGTGTCTGGGATGCAATAC
AGGGCTGGCCGTGGTGGTTTGGACATGAAGCTGAGACGGACCGAGGTTGCCTCGACACACCAGTTGGGTATAGTC
TTGCTGTCGTCTGACGCGACTGAGGCCTGGCCGTCTTGGATTAGATGCAGAGATGAGAGTACATACAGGTGCTAC
GTGTCGGTGTCCGCGGGTTACGAGGGATAGGCTTCTGGTGTTAGTGTGCCTATCGACATATTGGACCGAGGGCGG
CTCAGGTGACGAGGCCCTACAAGATGCAAAGACGTGCGTTTCACGAGGCTGATGTTCTGATTGAGAGCCATGAGT
CGCTAAAGTCTCCTTCTTCCTCAAACCGCCGATCCTCGTAACAGCAAAGACGACATGGCAACCACAGCGCTCACG
CCCTCTCAAGACGCTCTCAGACTCCGCCAGCAATCCGTCCGTACAAACCAACCGTCACTCCAGCAATTTGGAAGA
GCAATTTGGAAGAAAAAAAGAAGGCTTCTTTTAAACTTTTGGTGTTGGGGCCTCAGGGGATGACTTGAGTTTCGA
GCCGGTGGGAGGCGTAGCTCTGGTCTCGGACTACCTATTCTGAGGCGTGCGACGATGGTTCGGGCCGCGTTTCGG
CCGGGGGGCTAAGATGGGGGTGCTTGGGCTGGTGGACTTATAGGGTTGGGGGGGGGACGGAGTTGTGTCTTTGTT
ATCTGCTGGTGATGTCAAGGTTGCTTGGGATTTGAAGTTGGTGCTGATAAACAACAGGGTGAAGCTTGGAACACG
CAACTCTCACGCCTCATGACGATAGGCAGAGCATGGACCGCATACGCAATGAGAAGGGGCAGCTTCATACACGGT
CATCCGGACAGGGCATCGAGACGGAGACGGTTGGCGAGGCTGACGGCGATGTCGAAGGCAGGTGTACGACCGACT
TTGACTTTAAGAGGCTGGGGTGGCAGCGGCCGCCCGAGTTTAAGAATGCTTGGGTTGAGGCCTGCTTTGTGCTGT
CCTCGGTAGGGGCCTTGGCCATGGCTGTGAGTTGCTTCTCATGTTGCGAGTTGATGCTCTCAAACTAACACGGGG
GATAGGACTTCATCGTCGACGGCTTCCAAGTCCTGCTCCCCGCCCTCATCGACCCCCTTTCCATCCCCCCCGGCG
CGCAGATCTGGCCGTCGAGCGTTGTGACCATGGTTGCAGGCTCGTGTCTCTTCCCGCTGGGACGACTGACGGACA
TGTACGGCGGCTACCTCATCTTCAACGGCGGGTTAACCTGGTTCACGCTGTGGACGCTGGCAGCGGGATTCGCCA
CCAACTTCATCTTCCTCGTCTTCTGCCGCGCCATGCAGGGCTTGGGCATGGCTGCTTTCCTGCCCGCTGGGATAG
CCCTCCTCGGCCGCTTCTACCGGCCCGGTCCGCGCAAGAACCTCGTCTTCGCCCTGTACGGCGCTGCCTGTCCGG
TGGGCTTCTTCAGCGGGGTGCTGACGGCGGGATTCTCGCAGGAGGTGTTGGGGCAGTGGCGGTGGTTCTTCTGGG
TTGGCGGGTTGGTTACGGGGGTTTGCTGTGTTGGGACGGTGCTTTACTGTCCGAGGGATGAGGGGAATGCGGTTG
CTATGGATTGGCCTGGGACGTTGACGACGGTTCCGGCTATCATGCTGTTGCTTTATGCTGCGGCCAAGGGGACGG
GGTCGGGTATGGATGTGGTTGTTGCTTTGGTCTTGGGGGTTGTTTTCTTGGGGTTGGCTGTTGTGGTTGAGACGA
GGGTTGCGTCGCCGTTGATGCCGGCTGACATCTTTCGTATCAAGGATATGAAGGCTATGCTGTTGTTTCTGCTGT
TGTCATGGGGTGTTTACTCCATGTATCAGTTCTACACCAGCTTCTAGTACGTTGTTCTCCCCCCCCCCTTTTTTC
TGAGCTGGAGTTTGGTGGCTGACTTGGTTGGATGGTACAGCATGCAGATGGTGCTCAAGGTCTCGTCGCTGACGA
CGGCTCTTTGGTACGCCCCCTGGGCTGTTAGTGGCCTCATCTTTTCCACGCTGGGAGGTCTTGTTCTGGATAGGA
TCCCAGCGTCTTGGCTGCTCATCCCGTCGAGCATCTCGGCCATCATGGCAGTTCTACTCTTCGCCGTCATGCCTT
CCGAACCCAGCTACTGGCTCTGGATCTTCCCAGCCATGATCTTCGAGGCGGCCTCGGCTGATATTCTATGGACGG
TGAGCAACGTCTTCCTGACGACCAGCCTCCCGCGCCACCACCAGGGTCTCGCCGGCGCCATCATCAGCCTGACGC
TCTTCGTGGGCGACGCCCTCTTCCTGGCCGTGGGCGACGTGGTGGAAGAGTCGATGGCTGGAGCCGGGTCAGGGG
CTGAGACGCAGTACAAGGCTGTGTTTTGGGTGGCTGTTGTGATTGGCTTGGCGGCCTTGGGCACCAATTTCTTTA
TTCGGATTCCGGAGGCGTCGGCTGAGTTGACGGTGGATGAGAGGGATGAGTTGGAGTGGAAGCGGGGGAAGGAGG
ATTCTATGACGGATGCTGAGACGGTGGTTGGGTGTGAGATGGAGAATTTGTTGAAGGGATCGTGCGGTGAGGAGG
GGGAGGAGTTGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail