Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5909
Gene name
LocationContig_61:5529..7831
Strand+
Gene length (bp)2302
Transcript length (bp)2184
Coding sequence length (bp)2184
Protein length (aa) 728

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.9E-01 429 467
PF00400 WD40 WD domain, G-beta repeat 3.3E-04 660 690

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 223 691 1.0E-26
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 256 716 2.0E-18
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 256 691 6.0E-17
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 272 715 5.0E-16
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 283 716 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 223 691 1.0E-26
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 256 716 2.0E-18
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 256 691 6.0E-17
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 272 715 5.0E-16
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 283 716 1.0E-15
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 283 693 2.0E-15
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 283 691 2.0E-15
sp|Q9NZJ0|DTL_HUMAN Denticleless protein homolog OS=Homo sapiens GN=DTL PE=1 SV=3 283 691 4.0E-15
sp|Q24371|L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2 275 602 4.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 313 494 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2280
Ophiocordyceps australis map64 (Brazil) OphauB2|5992
Ophiocordyceps camponoti-floridani Ophcf2|06778
Ophiocordyceps camponoti-rufipedis Ophun1|5909 (this protein)
Ophiocordyceps kimflemingae Ophio5|2620
Ophiocordyceps subramaniannii Hirsu2|1164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5909
MESHSRSDDEMPSSPPAAAGFLSPKSFSTRSPSRLPSRLPSRSPSRSPPRTKRMKEKRVPSVTPRRLRTFFTPRT
RLSTSSRMTLGAMDSASVNRLAPRPLSPPPSSDPMEPPSSPTERLQAVEEASRKKRRVQSPGPGTKRRRTTLSDD
ESQLVTHENIANERRTLFFKASRKGVHGSGGKSLESSRPLLTATTEVTTAQDYQPQPIRKLRNRGFEACLLDREH
GFSVQAGKQHLAFPAADARIETAAFHSDSSDAYHCTPLGDQVGTSIPFSLASCHGAPVTAIGDERGDVRFLSTAG
GAGHQVQSWVKVHDNAIMDLAFSADDARLASACGDRSGRVLDTQTQTVAVELNDHWDSLRQVTFQPGGGNGNVLA
SSDRAGRVQVWDLRCSSLPAQCFSSATEGLVRDRGLEVAKARTVNTMDGAHERTTHGNTSSSSVTALQWLPAGRE
HLLLTGSEANATVKLWDTRYIKPRRHRQAAERPVASTPEPATHAWRSYGITSMTLGSDAARLYVVCKDSTVYAYS
TNHLVLGHAPELADGAGKRRPMGSQGLGPLYGLRNDALRVGSFYVKCAVRPSGRGGGMDELLAVGSSDGCAVLFP
TDERYLRTAWARREHMTMTTMTTTTAMAPPPPTTPSSTSFSNPISSSTTLPLIRTGTALIRGHSHEVTTLSWSSQ
GKLVTASDDCFVRQWQPKADRARHLRQVGEFGGERHLAGWAEVGDRWDVDEW*
Coding >Ophun1|5909
ATGGAGTCCCACAGTCGCTCTGATGATGAGATGCCCTCGAGCCCGCCGGCCGCTGCTGGCTTTCTCTCTCCCAAG
AGCTTCTCGACGAGATCGCCGTCGAGGCTCCCGTCGAGACTCCCGTCGAGATCCCCCTCCCGATCGCCGCCCAGA
ACGAAACGAATGAAGGAGAAGCGCGTGCCTTCGGTGACGCCGAGACGCCTCCGGACCTTTTTCACTCCGCGCACT
CGTCTATCTACGAGCAGTCGCATGACGCTGGGAGCCATGGATTCTGCTTCCGTCAACCGTCTGGCTCCGAGACCG
TTATCTCCCCCTCCTAGTTCGGATCCGATGGAGCCTCCATCGTCGCCGACGGAACGACTACAGGCTGTGGAAGAG
GCCTCGAGGAAGAAACGTCGGGTCCAATCTCCTGGGCCGGGGACCAAGCGACGACGGACAACGCTGTCCGACGAC
GAGTCCCAGTTAGTGACTCACGAGAATATCGCCAATGAGAGACGTACTCTTTTCTTCAAAGCAAGCCGCAAAGGA
GTCCATGGCTCGGGCGGCAAGTCTCTCGAGTCCAGTCGGCCATTGCTCACTGCAACGACAGAAGTAACGACGGCC
CAAGATTACCAGCCGCAACCGATTCGAAAGCTGCGCAATCGCGGTTTTGAAGCCTGTCTCCTCGACCGCGAGCAC
GGCTTCAGCGTCCAAGCCGGAAAGCAGCACCTCGCCTTTCCCGCCGCCGACGCCAGGATAGAGACGGCCGCTTTC
CACAGCGACAGCTCCGACGCCTACCACTGCACGCCATTGGGCGACCAGGTCGGCACGTCCATCCCCTTTAGCCTC
GCGAGCTGCCACGGCGCCCCGGTGACGGCCATCGGCGACGAACGGGGCGATGTGCGCTTCCTATCAACAGCCGGA
GGCGCGGGCCACCAGGTGCAGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGACCTCGCCTTCTCGGCCGAC
GACGCGCGGCTGGCCAGCGCATGCGGTGACAGATCCGGGCGCGTGCTGGACACGCAGACGCAGACGGTGGCCGTC
GAGCTGAACGACCACTGGGACTCGCTGCGGCAGGTGACCTTTCAGCCGGGCGGAGGCAACGGCAACGTGCTCGCG
TCTTCGGACCGGGCCGGACGGGTTCAAGTCTGGGACCTCCGATGCTCCTCCCTTCCGGCGCAGTGCTTCTCATCG
GCGACCGAAGGCCTGGTCCGGGACAGGGGACTGGAGGTGGCAAAGGCGCGGACGGTCAACACCATGGACGGCGCT
CACGAACGGACGACACACGGCAACACGTCGTCTTCGTCCGTCACGGCGCTACAGTGGCTACCGGCCGGGCGCGAG
CACCTCCTACTGACGGGCTCCGAGGCCAACGCAACAGTCAAGCTATGGGACACGCGCTACATCAAGCCACGACGA
CACCGACAGGCGGCAGAGCGACCGGTAGCGTCGACGCCGGAGCCGGCAACTCACGCGTGGCGCTCGTACGGCATC
ACCTCGATGACGCTCGGATCCGACGCCGCGCGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTACTCG
ACCAACCACCTCGTCCTCGGCCACGCGCCCGAACTGGCAGACGGAGCCGGCAAGCGTAGACCGATGGGGTCGCAG
GGTCTGGGCCCGCTGTACGGGCTCCGGAACGATGCGCTACGGGTCGGGTCCTTTTACGTCAAGTGCGCTGTTCGT
CCGTCTGGTCGTGGCGGTGGCATGGACGAGCTCTTGGCTGTGGGGAGCTCCGATGGCTGTGCGGTCTTGTTCCCT
ACGGATGAGCGTTACCTCCGGACGGCGTGGGCTCGTCGCGAACACATGACGATGACGACGATGACGACGACGACG
GCCATGGCTCCTCCGCCACCGACGACGCCATCATCGACCTCGTTTTCGAACCCTATATCCTCGTCGACGACCCTT
CCCCTGATCCGCACAGGAACGGCTCTCATCCGCGGCCACAGCCACGAAGTGACAACACTGAGCTGGTCGTCACAA
GGAAAGCTCGTGACCGCTTCCGACGACTGCTTCGTCCGGCAATGGCAGCCCAAGGCAGACCGGGCGCGTCATCTC
CGGCAGGTGGGCGAGTTTGGCGGCGAGAGGCACCTTGCAGGCTGGGCCGAGGTCGGGGACCGGTGGGATGTGGAT
GAATGGTGA
Transcript >Ophun1|5909
ATGGAGTCCCACAGTCGCTCTGATGATGAGATGCCCTCGAGCCCGCCGGCCGCTGCTGGCTTTCTCTCTCCCAAG
AGCTTCTCGACGAGATCGCCGTCGAGGCTCCCGTCGAGACTCCCGTCGAGATCCCCCTCCCGATCGCCGCCCAGA
ACGAAACGAATGAAGGAGAAGCGCGTGCCTTCGGTGACGCCGAGACGCCTCCGGACCTTTTTCACTCCGCGCACT
CGTCTATCTACGAGCAGTCGCATGACGCTGGGAGCCATGGATTCTGCTTCCGTCAACCGTCTGGCTCCGAGACCG
TTATCTCCCCCTCCTAGTTCGGATCCGATGGAGCCTCCATCGTCGCCGACGGAACGACTACAGGCTGTGGAAGAG
GCCTCGAGGAAGAAACGTCGGGTCCAATCTCCTGGGCCGGGGACCAAGCGACGACGGACAACGCTGTCCGACGAC
GAGTCCCAGTTAGTGACTCACGAGAATATCGCCAATGAGAGACGTACTCTTTTCTTCAAAGCAAGCCGCAAAGGA
GTCCATGGCTCGGGCGGCAAGTCTCTCGAGTCCAGTCGGCCATTGCTCACTGCAACGACAGAAGTAACGACGGCC
CAAGATTACCAGCCGCAACCGATTCGAAAGCTGCGCAATCGCGGTTTTGAAGCCTGTCTCCTCGACCGCGAGCAC
GGCTTCAGCGTCCAAGCCGGAAAGCAGCACCTCGCCTTTCCCGCCGCCGACGCCAGGATAGAGACGGCCGCTTTC
CACAGCGACAGCTCCGACGCCTACCACTGCACGCCATTGGGCGACCAGGTCGGCACGTCCATCCCCTTTAGCCTC
GCGAGCTGCCACGGCGCCCCGGTGACGGCCATCGGCGACGAACGGGGCGATGTGCGCTTCCTATCAACAGCCGGA
GGCGCGGGCCACCAGGTGCAGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGACCTCGCCTTCTCGGCCGAC
GACGCGCGGCTGGCCAGCGCATGCGGTGACAGATCCGGGCGCGTGCTGGACACGCAGACGCAGACGGTGGCCGTC
GAGCTGAACGACCACTGGGACTCGCTGCGGCAGGTGACCTTTCAGCCGGGCGGAGGCAACGGCAACGTGCTCGCG
TCTTCGGACCGGGCCGGACGGGTTCAAGTCTGGGACCTCCGATGCTCCTCCCTTCCGGCGCAGTGCTTCTCATCG
GCGACCGAAGGCCTGGTCCGGGACAGGGGACTGGAGGTGGCAAAGGCGCGGACGGTCAACACCATGGACGGCGCT
CACGAACGGACGACACACGGCAACACGTCGTCTTCGTCCGTCACGGCGCTACAGTGGCTACCGGCCGGGCGCGAG
CACCTCCTACTGACGGGCTCCGAGGCCAACGCAACAGTCAAGCTATGGGACACGCGCTACATCAAGCCACGACGA
CACCGACAGGCGGCAGAGCGACCGGTAGCGTCGACGCCGGAGCCGGCAACTCACGCGTGGCGCTCGTACGGCATC
ACCTCGATGACGCTCGGATCCGACGCCGCGCGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTACTCG
ACCAACCACCTCGTCCTCGGCCACGCGCCCGAACTGGCAGACGGAGCCGGCAAGCGTAGACCGATGGGGTCGCAG
GGTCTGGGCCCGCTGTACGGGCTCCGGAACGATGCGCTACGGGTCGGGTCCTTTTACGTCAAGTGCGCTGTTCGT
CCGTCTGGTCGTGGCGGTGGCATGGACGAGCTCTTGGCTGTGGGGAGCTCCGATGGCTGTGCGGTCTTGTTCCCT
ACGGATGAGCGTTACCTCCGGACGGCGTGGGCTCGTCGCGAACACATGACGATGACGACGATGACGACGACGACG
GCCATGGCTCCTCCGCCACCGACGACGCCATCATCGACCTCGTTTTCGAACCCTATATCCTCGTCGACGACCCTT
CCCCTGATCCGCACAGGAACGGCTCTCATCCGCGGCCACAGCCACGAAGTGACAACACTGAGCTGGTCGTCACAA
GGAAAGCTCGTGACCGCTTCCGACGACTGCTTCGTCCGGCAATGGCAGCCCAAGGCAGACCGGGCGCGTCATCTC
CGGCAGGTGGGCGAGTTTGGCGGCGAGAGGCACCTTGCAGGCTGGGCCGAGGTCGGGGACCGGTGGGATGTGGAT
GAATGGTGA
Gene >Ophun1|5909
ATGGAGTCCCACAGTCGCTCTGATGATGAGATGCCCTCGAGCCCGCCGGCCGCTGCTGGCTTTCTCTCTCCCAAG
AGCTTCTCGACGAGATCGCCGTCGAGGCTCCCGTCGAGACTCCCGTCGAGATCCCCCTCCCGATCGCCGCCCAGA
ACGAAACGAATGAAGGAGAAGCGCGTGCCTTCGGTGACGCCGAGACGCCTCCGGACCTTTTTCACTCCGCGCACT
CGTCTATCTACGAGCAGTCGCATGACGCTGGGAGCCATGGATTCTGCTTCCGTCAACCGTCTGGCTCCGAGACCG
TTATCTCCCCCTCCTAGTTCGGATCCGATGGAGCCTCCATCGTCGCCGACGGAACGACTACAGGCTGTGGAAGAG
GCCTCGAGGAAGAAACGTCGGGTCCAATCTCCTGGGCCGGGGACCAAGCGACGACGGACAACGCTGTCCGACGAC
GAGTCCCAGTTAGTGACTCACGAGAATATCGCCAATGAGAGACGTACTCTTGTGAGCGGCAGCCGAACCATCTAC
CCTTGGCCTAGTCACTCACCGTTGCAGAAACAGTTCTTCAAAGCAAGCCGCAAAGGAGTCCATGGCTCGGGCGGC
AAGTCTCTCGAGTCCAGTCGGCCATTGCTCACTGCAACGACAGAAGTAACGACGGTAAGCGGATGACCATCATCT
GCTCTCTGTATCTCGTTCACATTTGACTCTTGTCTCGCAGGCCCAAGATTACCAGCCGCAACCGATTCGAAAGCT
GCGCAATCGCGGTTTTGAAGCCTGTCTCCTCGACCGCGAGCACGGCTTCAGCGTCCAAGCCGGAAAGCAGCACCT
CGCCTTTCCCGCCGCCGACGCCAGGATAGAGACGGCCGCTTTCCACAGCGACAGCTCCGACGCCTACCACTGCAC
GCCATTGGGCGACCAGGTCGGCACGTCCATCCCCTTTAGCCTCGCGAGCTGCCACGGCGCCCCGGTGACGGCCAT
CGGCGACGAACGGGGCGATGTGCGCTTCCTATCAACAGCCGGAGGCGCGGGCCACCAGGTGCAGAGCTGGGTCAA
GGTGCACGACAACGCCATCATGGACCTCGCCTTCTCGGCCGACGACGCGCGGCTGGCCAGCGCATGCGGTGACAG
ATCCGGGCGCGTGCTGGACACGCAGACGCAGACGGTGGCCGTCGAGCTGAACGACCACTGGGACTCGCTGCGGCA
GGTGACCTTTCAGCCGGGCGGAGGCAACGGCAACGTGCTCGCGTCTTCGGACCGGGCCGGACGGGTTCAAGTCTG
GGACCTCCGATGCTCCTCCCTTCCGGCGCAGTGCTTCTCATCGGCGACCGAAGGCCTGGTCCGGGACAGGGGACT
GGAGGTGGCAAAGGCGCGGACGGTCAACACCATGGACGGCGCTCACGAACGGACGACACACGGCAACACGTCGTC
TTCGTCCGTCACGGCGCTACAGTGGCTACCGGCCGGGCGCGAGCACCTCCTACTGACGGGCTCCGAGGCCAACGC
AACAGTCAAGCTATGGGACACGCGCTACATCAAGCCACGACGACACCGACAGGCGGCAGAGCGACCGGTAGCGTC
GACGCCGGAGCCGGCAACTCACGCGTGGCGCTCGTACGGCATCACCTCGATGACGCTCGGATCCGACGCCGCGCG
GCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTACTCGACCAACCACCTCGTCCTCGGCCACGCGCCCGA
ACTGGCAGACGGAGCCGGCAAGCGTAGACCGATGGGGTCGCAGGGTCTGGGCCCGCTGTACGGGCTCCGGAACGA
TGCGCTACGGGTCGGGTCCTTTTACGTCAAGTGCGCTGTTCGTCCGTCTGGTCGTGGCGGTGGCATGGACGAGCT
CTTGGCTGTGGGGAGCTCCGATGGCTGTGCGGTCTTGTTCCCTACGGATGAGCGTTACCTCCGGACGGCGTGGGC
TCGTCGCGAACACATGACGATGACGACGATGACGACGACGACGGCCATGGCTCCTCCGCCACCGACGACGCCATC
ATCGACCTCGTTTTCGAACCCTATATCCTCGTCGACGACCCTTCCCCTGATCCGCACAGGAACGGCTCTCATCCG
CGGCCACAGCCACGAAGTGACAACACTGAGCTGGTCGTCACAAGGAAAGCTCGTGACCGCTTCCGACGACTGCTT
CGTCCGGCAATGGCAGCCCAAGGCAGACCGGGCGCGTCATCTCCGGCAGGTGGGCGAGTTTGGCGGCGAGAGGCA
CCTTGCAGGCTGGGCCGAGGTCGGGGACCGGTGGGATGTGGATGAATGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail