Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5905
Gene name
LocationContig_609:9179..10856
Strand+
Gene length (bp)1677
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.5E-06 220 318
PF00067 p450 Cytochrome P450 1.5E-14 337 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 29 444 2.0E-29
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 12 453 9.0E-22
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 22 453 7.0E-21
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 22 453 7.0E-21
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 29 436 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 29 444 2.0E-29
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 12 453 9.0E-22
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 22 453 7.0E-21
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 22 453 7.0E-21
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 29 436 1.0E-20
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 10 436 2.0E-20
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 28 436 1.0E-18
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 10 444 1.0E-18
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 28 470 2.0E-18
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 36 468 4.0E-16
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 273 436 5.0E-15
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 32 445 1.0E-14
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 273 436 9.0E-14
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 265 437 3.0E-13
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 88 462 4.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 186 431 4.0E-13
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 159 431 2.0E-12
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 267 443 3.0E-11
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 201 432 1.0E-10
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 224 431 2.0E-10
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 238 431 3.0E-10
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 262 439 7.0E-10
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 201 454 7.0E-10
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 237 443 2.0E-09
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 199 431 2.0E-09
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 219 427 2.0E-09
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 199 431 3.0E-09
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 230 431 3.0E-09
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 229 428 4.0E-09
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 199 435 6.0E-09
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 234 431 7.0E-09
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 186 431 8.0E-09
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 196 460 9.0E-09
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 246 443 9.0E-09
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 219 432 1.0E-08
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 273 431 1.0E-08
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 224 431 2.0E-08
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 273 444 2.0E-08
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 273 444 2.0E-08
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 67 441 2.0E-08
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 195 432 2.0E-08
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 215 429 3.0E-08
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 186 470 3.0E-08
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 223 451 4.0E-08
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 263 432 8.0E-08
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 172 468 8.0E-08
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 281 436 9.0E-08
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 263 432 1.0E-07
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 217 436 2.0E-07
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 245 427 2.0E-07
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 231 432 3.0E-07
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 186 470 3.0E-07
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 238 431 3.0E-07
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 272 431 3.0E-07
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 199 442 3.0E-07
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 229 435 4.0E-07
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 243 431 4.0E-07
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 245 435 5.0E-07
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 211 431 5.0E-07
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 263 432 5.0E-07
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 277 428 7.0E-07
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 274 439 1.0E-06
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 262 439 1.0E-06
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 219 431 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5905
MATLLEWFGLVLFKVPLLVSLLLTAWILYNIYLHPLSHIPGPFWDRATGIPSWYATIQGRRHLYLSQQFDLYGDR
IRPEPGTVLFRGPAAHADIYGARSNVRRSCFYRAFNRTRKIDETTFTTTDVAAHARKRKVLNVCFTERLVKAAAP
FIVRHVDRFGRSFDIKEGGENSVKEVPDCISSALQFYYPICRSPFLKPFVWLKPRGLDRALQMISPPTVHKYNDF
VCSSVADRLALQKEQASRPEAERRQDMFYFLADARHADTGKAAYGEDELRAECSVLITAGSGTTSVSLSGVFFYL
SGDEKRYNKLVDEIRSSFASLQDVVYGPVLLGCREHPREVLEGGIRIADEFYPAGTIVGTVPWADSRNGAIYGDA
HVFRPERWIVDEETGTTKEEVSRLRANFHPFLSGPCSCIGKNLALMEMYVTVARTLFCLDVRRVAGSRDGGELRL
RDAFVSLREGPEVQFRRRCE*
Coding >Ophun1|5905
ATGGCGACTTTGTTGGAGTGGTTCGGCCTCGTTCTCTTCAAGGTCCCGCTGCTGGTTTCGCTGCTGTTGACAGCC
TGGATCCTCTACAACATCTACCTCCACCCCCTATCCCACATCCCCGGCCCCTTCTGGGACCGCGCAACGGGCATC
CCCTCGTGGTACGCCACCATCCAAGGCCGCCGCCACCTCTACCTCAGCCAGCAATTCGACCTCTACGGCGACCGC
ATCCGCCCGGAGCCCGGAACGGTGCTCTTCCGCGGACCGGCGGCCCACGCCGACATCTACGGCGCGCGCTCCAAC
GTGCGGAGAAGCTGCTTCTACCGGGCCTTCAACCGGACGCGTAAAATCGACGAGACGACCTTTACGACGACGGAT
GTGGCGGCGCATGCGAGGAAGAGGAAGGTTCTCAACGTTTGTTTCACCGAGAGGTTGGTCAAGGCGGCGGCGCCG
TTTATTGTTAGGCATGTTGATCGCTTCGGGCGCTCGTTTGATATCAAGGAAGGGGGGGAGAATTCGGTCAAGGAG
GTTCCGGATTGCATCTCGTCGGCGCTGCAGTTTTATTACCCGATCTGCCGCTCGCCCTTCCTCAAGCCCTTTGTC
TGGCTGAAGCCCCGAGGCCTCGACCGGGCCCTGCAGATGATCTCCCCGCCGACGGTGCACAAGTACAACGACTTT
GTATGCTCGAGCGTCGCCGACAGACTGGCGCTGCAAAAGGAGCAGGCTTCCCGTCCCGAGGCGGAGCGCAGGCAG
GACATGTTCTACTTCCTCGCCGACGCGCGCCACGCGGATACGGGGAAGGCGGCGTACGGGGAAGACGAGCTGCGG
GCGGAATGCAGCGTGCTCATCACGGCCGGGTCGGGGACGACGTCTGTCAGCCTGTCGGGCGTCTTCTTCTACCTC
AGCGGCGACGAGAAGCGGTACAACAAGCTGGTGGACGAGATTCGGTCCTCGTTTGCAAGTCTGCAAGATGTTGTC
TATGGGCCTGTCTTGCTGGGGTGTCGCGAGCATCCTCGTGAGGTTCTCGAGGGGGGCATTCGCATCGCCGACGAG
TTTTATCCTGCTGGGACCATCGTGGGGACGGTGCCGTGGGCGGATTCACGCAACGGGGCGATATACGGCGACGCG
CACGTGTTTCGACCTGAGCGGTGGATCGTCGACGAGGAGACGGGGACGACGAAGGAGGAGGTTTCGAGGTTGAGG
GCCAACTTTCACCCGTTCCTGAGTGGGCCCTGCAGCTGCATCGGGAAGAATCTGGCGTTGATGGAGATGTATGTC
ACGGTTGCGAGGACGCTGTTTTGCCTTGATGTGAGGAGGGTTGCGGGATCGAGGGATGGGGGGGAGTTGAGGCTG
AGGGATGCGTTTGTGTCGTTGAGGGAGGGGCCTGAGGTGCAGTTCCGGCGGAGGTGCGAGTGA
Transcript >Ophun1|5905
ATGGCGACTTTGTTGGAGTGGTTCGGCCTCGTTCTCTTCAAGGTCCCGCTGCTGGTTTCGCTGCTGTTGACAGCC
TGGATCCTCTACAACATCTACCTCCACCCCCTATCCCACATCCCCGGCCCCTTCTGGGACCGCGCAACGGGCATC
CCCTCGTGGTACGCCACCATCCAAGGCCGCCGCCACCTCTACCTCAGCCAGCAATTCGACCTCTACGGCGACCGC
ATCCGCCCGGAGCCCGGAACGGTGCTCTTCCGCGGACCGGCGGCCCACGCCGACATCTACGGCGCGCGCTCCAAC
GTGCGGAGAAGCTGCTTCTACCGGGCCTTCAACCGGACGCGTAAAATCGACGAGACGACCTTTACGACGACGGAT
GTGGCGGCGCATGCGAGGAAGAGGAAGGTTCTCAACGTTTGTTTCACCGAGAGGTTGGTCAAGGCGGCGGCGCCG
TTTATTGTTAGGCATGTTGATCGCTTCGGGCGCTCGTTTGATATCAAGGAAGGGGGGGAGAATTCGGTCAAGGAG
GTTCCGGATTGCATCTCGTCGGCGCTGCAGTTTTATTACCCGATCTGCCGCTCGCCCTTCCTCAAGCCCTTTGTC
TGGCTGAAGCCCCGAGGCCTCGACCGGGCCCTGCAGATGATCTCCCCGCCGACGGTGCACAAGTACAACGACTTT
GTATGCTCGAGCGTCGCCGACAGACTGGCGCTGCAAAAGGAGCAGGCTTCCCGTCCCGAGGCGGAGCGCAGGCAG
GACATGTTCTACTTCCTCGCCGACGCGCGCCACGCGGATACGGGGAAGGCGGCGTACGGGGAAGACGAGCTGCGG
GCGGAATGCAGCGTGCTCATCACGGCCGGGTCGGGGACGACGTCTGTCAGCCTGTCGGGCGTCTTCTTCTACCTC
AGCGGCGACGAGAAGCGGTACAACAAGCTGGTGGACGAGATTCGGTCCTCGTTTGCAAGTCTGCAAGATGTTGTC
TATGGGCCTGTCTTGCTGGGGTGTCGCGAGCATCCTCGTGAGGTTCTCGAGGGGGGCATTCGCATCGCCGACGAG
TTTTATCCTGCTGGGACCATCGTGGGGACGGTGCCGTGGGCGGATTCACGCAACGGGGCGATATACGGCGACGCG
CACGTGTTTCGACCTGAGCGGTGGATCGTCGACGAGGAGACGGGGACGACGAAGGAGGAGGTTTCGAGGTTGAGG
GCCAACTTTCACCCGTTCCTGAGTGGGCCCTGCAGCTGCATCGGGAAGAATCTGGCGTTGATGGAGATGTATGTC
ACGGTTGCGAGGACGCTGTTTTGCCTTGATGTGAGGAGGGTTGCGGGATCGAGGGATGGGGGGGAGTTGAGGCTG
AGGGATGCGTTTGTGTCGTTGAGGGAGGGGCCTGAGGTGCAGTTCCGGCGGAGGTGCGAGTGA
Gene >Ophun1|5905
ATGGCGACTTTGTTGGAGTGGTTCGGCCTCGTTCTCTTCAAGGTCCCGCTGCTGGTTTCGCTGCTGGTAAGGCCA
CCCACCAAGATATCCATAACATCATCATCTCACCACATACCTATCCTCTCCAGTTGACAGCCTGGATCCTCTACA
ACATCTACCTCCACCCCCTATCCCACATCCCCGGCCCCTTCTGGGACCGCGCAACGGGCATCCCCTCGTGGTACG
CCACCATCCAAGGCCGCCGCCACCTCTACCTCAGCCAGCAATTCGACCTCTACGGCGACCGCATCCGCCCGGAGC
CCGGAACGGTGCTCTTCCGCGGACCGGCGGCCCACGCCGACATCTACGGCGCGCGCTCCAACGTGCGGAGAAGCT
GCTTCTACCGGGCCTTCAACCGGACGCGTAAAATCGACGAGACGACCTTTACGACGACGGATGTGGCGGCGCATG
CGAGGAAGAGGAAGGTTCTCAACGTTTGTTTCACCGAGAGGTTGGTCAAGGCGGCGGCGCCGTTTATTGTTAGGC
ATGTTGATCGGTGGGTTGACTTGTTGGCTGATGAGGGGGAGGGGTGGTCTTCTGCTGTTGATTTTTCAGTCGTGG
TTGATGCCTTGATTTTTGATATCATGGGCGATCTCAGCTTCGGGCGCTCGTTTGATATCAAGGAAGGGGGGGAGA
ATTCGGTCAAGGAGGTTCCGGATTGCATCTCGTCGGCGCTGCAGTTTTATTACCCGGTAAGAATCCGCGTTTCCC
ATCTTGAACGACGTCTAACCAGGACAGATCTGCCGCTCGCCCTTCCTCAAGCCCTTTGTCTGGCTGAAGCCCCGA
GGCCTCGACCGGGCCCTGCAGATGATCTCCCCGCCGACGGTGCACAAGTACAACGACTTTGTATGCTCGAGCGTC
GCCGACAGACTGGCGCTGCAAAAGGAGCAGGCTTCCCGTCCCGAGGCGGAGCGCAGGCAGGACATGTTCTACTTC
CTCGCCGACGCGCGCCACGCGGATACGGGGAAGGCGGCGTACGGGGAAGACGAGCTGCGGGCGGAATGCAGCGTG
CTCATCACGGCCGGGTCGGGGACGACGTCTGTCAGCCTGTCGGGCGTCTTCTTCTACCTCAGCGGCGACGAGAAG
CGGTACAACAAGCTGGTGGACGAGATTCGGTCCTCGTTTGCAAGTCTGCAAGATGTTGTCTATGGGCCTGTCTTG
CTGGGGTGTCGGTATTTGAGGGCTTGTGTGGACGAGGGGATGCGGCTGACGCCGGCGGGGGCGAGCGAGCATCCT
CGTGAGGTTCTCGAGGGGGGCATTCGCATCGCCGACGAGTTTTATCCTGCTGGGACCATCGTGGGGACGGTGCCG
TGGGCGGATTCACGCAACGGGGCGATATACGGCGACGCGCACGTGTTTCGACCTGAGCGGTGGATCGTCGACGAG
GAGACGGGGACGACGAAGGAGGAGGTTTCGAGGTTGAGGGCCAACTTTCACCCGTTCCTGAGTGGGCCCTGCAGC
TGCATCGGGAAGAATCTGGCGTTGATGGAGATGTATGTCACGGTTGCGAGGACGCTGTTTTGCCTTGATGTGAGG
AGGGTTGCGGGATCGAGGGATGGGGGGGAGTTGAGGCTGAGGGATGCGTTTGTGTCGTTGAGGGAGGGGCCTGAG
GTGCAGTTCCGGCGGAGGTGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail