Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|590
Gene name
LocationContig_1184:678..3068
Strand-
Gene length (bp)2390
Transcript length (bp)2088
Coding sequence length (bp)2088
Protein length (aa) 696

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 1.1E-75 107 338
PF16335 DUF4965 Domain of unknown function (DUF4965) 3.9E-72 346 514
PF08760 DUF1793 Domain of unknown function (DUF1793) 2.3E-61 520 692

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U4L7|GTAA_ASPOR Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gtaA PE=1 SV=2 1 693 0.0E+00
sp|D4AMT2|GTAA_ARTBC Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05535/05536 PE=1 SV=2 30 694 5.0E-116

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999621

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1433
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|351
Ophiocordyceps australis map64 (Brazil) OphauB2|5236
Ophiocordyceps camponoti-floridani Ophcf2|06862
Ophiocordyceps camponoti-rufipedis Ophun1|590 (this protein)
Ophiocordyceps kimflemingae Ophio5|929
Ophiocordyceps subramaniannii Hirsu2|10951

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|590
MKFVKLAAAAVLTVLGREAEADSQFFPARPPAAPLAVRSPFLNVWLNGQPNGGRHGYLPGQWPRFWTESVQGWQG
YVRVDGKAFNWMGDAPVKAPNVDQVSLEYTSTKTTFIMNVDGKVQLKAEFLSPVYPDDLRRQSITSSYLQVSARS
LDGRPHNVQIYCDVSGEWASGDTSAVIQWESGTRDNVRYHKFHRKDQQVFKDINEIASWGNWYWATGNQDGVTTE
IGADNYVRNMFVRDGRLRDQVDPKHRAIRDNWPVFAFARDLKDVTGSWKDTLFTIGYTQDDAINFQGKEAQPRAV
PSLWRSFHREDQLVSIFYKDYNYAVQYSRSLDDRINRDSQAVAGSAGKNYATMTTLAVRQVFGALGFTGTQQQPL
VFLKEISSNSDIQTVDVIFPAFPILLYLNPDLLRYMLDPLLENGRTHYPNNYAQHDLGRYPVALGHPKGDDEQMP
LEECGNMVIMMLAYAQRKRDNGYLAANWDLLDKWAQYLVQDAKIPANQLSTDDFAGHLANQTNLALKGIIALEAM
SRIAGSTGHAEQQKRYGDTARDYLRFWQQHAINTRANPRHTMLQYDSPDSYGLLYNIYSDKVLNLNFVPQSVYDM
QSDFYLSVQKRFGVILDTRGTLTKLDWEMFSAAVAKEPTRNMFINKIADWINQTPTWRAFTDLYDTGSGGYPSAG
LQFTARPVQGGVFSLLALRT*
Coding >Ophun1|590
ATGAAGTTCGTCAAGCTCGCTGCCGCCGCCGTCCTCACCGTCCTCGGACGTGAGGCTGAGGCCGATTCGCAGTTC
TTCCCGGCTCGTCCTCCCGCCGCGCCCCTCGCCGTTCGCTCTCCCTTTCTCAACGTCTGGCTCAACGGTCAGCCC
AACGGTGGCAGGCATGGCTACCTGCCTGGCCAGTGGCCGCGATTCTGGACAGAGTCGGTTCAGGGCTGGCAAGGT
TACGTCAGGGTCGACGGCAAGGCCTTCAACTGGATGGGCGACGCCCCTGTCAAGGCCCCCAATGTCGATCAGGTC
TCCCTCGAGTACACGTCCACCAAGACGACATTTATCATGAATGTCGACGGCAAGGTTCAGCTCAAGGCCGAGTTT
CTGTCCCCCGTCTATCCCGACGATCTGCGCCGCCAGTCCATCACCTCGTCCTACCTCCAGGTTTCTGCCAGATCC
CTGGATGGTCGACCTCACAACGTTCAGATCTACTGTGACGTCTCCGGCGAATGGGCTTCGGGCGATACCAGTGCC
GTCATCCAGTGGGAGAGCGGCACGAGGGACAATGTGCGCTATCACAAGTTTCACCGCAAGGACCAGCAGGTTTTC
AAGGACATCAATGAGATCGCCTCGTGGGGCAACTGGTACTGGGCCACCGGTAACCAGGACGGTGTCACTACCGAG
ATCGGCGCCGACAACTATGTCCGCAACATGTTTGTCAGGGATGGCCGCCTCCGGGATCAGGTCGACCCCAAGCAT
CGCGCCATCCGCGACAACTGGCCCGTCTTTGCCTTTGCCAGGGATCTCAAGGACGTCACCGGCAGCTGGAAGGAC
ACCCTCTTCACCATCGGCTACACGCAGGACGACGCCATCAACTTCCAGGGCAAGGAGGCCCAGCCCCGCGCCGTG
CCGTCCCTGTGGAGGAGCTTCCACCGCGAGGACCAGCTCGTCAGCATCTTTTACAAGGACTACAACTATGCCGTC
CAGTACTCGAGGTCCCTCGACGACCGCATCAACCGCGACTCGCAGGCGGTGGCGGGCTCGGCTGGCAAGAACTAT
GCCACCATGACGACGCTGGCCGTCCGCCAGGTCTTTGGCGCCCTCGGCTTCACCGGCACCCAGCAGCAGCCGCTC
GTCTTCCTCAAGGAAATCAGCTCCAACAGCGACATCCAGACCGTCGACGTCATCTTCCCGGCCTTCCCCATCCTG
CTCTACCTCAACCCCGACCTGCTGCGCTACATGCTGGACCCCCTGCTGGAGAATGGCCGCACGCACTACCCCAAC
AACTACGCCCAGCACGACCTCGGCCGCTATCCCGTCGCCCTGGGCCATCCCAAGGGCGACGACGAGCAGATGCCG
CTGGAGGAGTGCGGCAACATGGTCATCATGATGCTCGCGTACGCCCAGCGGAAGCGCGACAATGGTTATCTGGCG
GCCAACTGGGACCTGCTGGATAAGTGGGCGCAGTACCTGGTTCAGGACGCCAAGATTCCGGCCAACCAGCTGTCG
ACGGACGACTTTGCTGGTCATCTTGCCAACCAGACGAACCTGGCCCTCAAGGGCATCATCGCCCTCGAAGCCATG
TCGCGCATCGCCGGCTCGACCGGTCACGCCGAACAGCAAAAGAGGTACGGCGACACGGCTCGAGACTATCTCAGG
TTCTGGCAGCAGCACGCCATCAACACCAGGGCCAACCCGAGGCACACGATGCTGCAATACGACAGCCCCGACTCT
TACGGCCTGCTGTACAACATTTACTCGGACAAGGTGCTCAACCTCAACTTTGTCCCGCAATCCGTCTACGACATG
CAGAGCGACTTTTACCTCAGCGTCCAGAAGCGCTTCGGCGTCATCCTCGACACGCGCGGCACCCTGACCAAGCTC
GACTGGGAGATGTTTTCGGCCGCCGTGGCCAAGGAGCCCACGCGCAACATGTTTATCAACAAGATTGCCGACTGG
ATCAACCAGACGCCCACCTGGCGGGCCTTTACCGACCTGTACGACACGGGGTCGGGCGGATACCCGTCGGCCGGA
CTGCAGTTTACGGCGCGACCGGTCCAGGGCGGCGTCTTTTCCCTGCTGGCGCTGCGGACGTGA
Transcript >Ophun1|590
ATGAAGTTCGTCAAGCTCGCTGCCGCCGCCGTCCTCACCGTCCTCGGACGTGAGGCTGAGGCCGATTCGCAGTTC
TTCCCGGCTCGTCCTCCCGCCGCGCCCCTCGCCGTTCGCTCTCCCTTTCTCAACGTCTGGCTCAACGGTCAGCCC
AACGGTGGCAGGCATGGCTACCTGCCTGGCCAGTGGCCGCGATTCTGGACAGAGTCGGTTCAGGGCTGGCAAGGT
TACGTCAGGGTCGACGGCAAGGCCTTCAACTGGATGGGCGACGCCCCTGTCAAGGCCCCCAATGTCGATCAGGTC
TCCCTCGAGTACACGTCCACCAAGACGACATTTATCATGAATGTCGACGGCAAGGTTCAGCTCAAGGCCGAGTTT
CTGTCCCCCGTCTATCCCGACGATCTGCGCCGCCAGTCCATCACCTCGTCCTACCTCCAGGTTTCTGCCAGATCC
CTGGATGGTCGACCTCACAACGTTCAGATCTACTGTGACGTCTCCGGCGAATGGGCTTCGGGCGATACCAGTGCC
GTCATCCAGTGGGAGAGCGGCACGAGGGACAATGTGCGCTATCACAAGTTTCACCGCAAGGACCAGCAGGTTTTC
AAGGACATCAATGAGATCGCCTCGTGGGGCAACTGGTACTGGGCCACCGGTAACCAGGACGGTGTCACTACCGAG
ATCGGCGCCGACAACTATGTCCGCAACATGTTTGTCAGGGATGGCCGCCTCCGGGATCAGGTCGACCCCAAGCAT
CGCGCCATCCGCGACAACTGGCCCGTCTTTGCCTTTGCCAGGGATCTCAAGGACGTCACCGGCAGCTGGAAGGAC
ACCCTCTTCACCATCGGCTACACGCAGGACGACGCCATCAACTTCCAGGGCAAGGAGGCCCAGCCCCGCGCCGTG
CCGTCCCTGTGGAGGAGCTTCCACCGCGAGGACCAGCTCGTCAGCATCTTTTACAAGGACTACAACTATGCCGTC
CAGTACTCGAGGTCCCTCGACGACCGCATCAACCGCGACTCGCAGGCGGTGGCGGGCTCGGCTGGCAAGAACTAT
GCCACCATGACGACGCTGGCCGTCCGCCAGGTCTTTGGCGCCCTCGGCTTCACCGGCACCCAGCAGCAGCCGCTC
GTCTTCCTCAAGGAAATCAGCTCCAACAGCGACATCCAGACCGTCGACGTCATCTTCCCGGCCTTCCCCATCCTG
CTCTACCTCAACCCCGACCTGCTGCGCTACATGCTGGACCCCCTGCTGGAGAATGGCCGCACGCACTACCCCAAC
AACTACGCCCAGCACGACCTCGGCCGCTATCCCGTCGCCCTGGGCCATCCCAAGGGCGACGACGAGCAGATGCCG
CTGGAGGAGTGCGGCAACATGGTCATCATGATGCTCGCGTACGCCCAGCGGAAGCGCGACAATGGTTATCTGGCG
GCCAACTGGGACCTGCTGGATAAGTGGGCGCAGTACCTGGTTCAGGACGCCAAGATTCCGGCCAACCAGCTGTCG
ACGGACGACTTTGCTGGTCATCTTGCCAACCAGACGAACCTGGCCCTCAAGGGCATCATCGCCCTCGAAGCCATG
TCGCGCATCGCCGGCTCGACCGGTCACGCCGAACAGCAAAAGAGGTACGGCGACACGGCTCGAGACTATCTCAGG
TTCTGGCAGCAGCACGCCATCAACACCAGGGCCAACCCGAGGCACACGATGCTGCAATACGACAGCCCCGACTCT
TACGGCCTGCTGTACAACATTTACTCGGACAAGGTGCTCAACCTCAACTTTGTCCCGCAATCCGTCTACGACATG
CAGAGCGACTTTTACCTCAGCGTCCAGAAGCGCTTCGGCGTCATCCTCGACACGCGCGGCACCCTGACCAAGCTC
GACTGGGAGATGTTTTCGGCCGCCGTGGCCAAGGAGCCCACGCGCAACATGTTTATCAACAAGATTGCCGACTGG
ATCAACCAGACGCCCACCTGGCGGGCCTTTACCGACCTGTACGACACGGGGTCGGGCGGATACCCGTCGGCCGGA
CTGCAGTTTACGGCGCGACCGGTCCAGGGCGGCGTCTTTTCCCTGCTGGCGCTGCGGACGTGA
Gene >Ophun1|590
ATGAAGTTCGTCAAGCTCGCTGCCGCCGCCGTCCTCACCGTCCTCGGACGTGAGGCTGAGGCCGATTCGCAGTTC
TTCCCGGCTCGTCCTCCCGCCGCGCCCCTCGCCGTTCGCTCTCCCTTTCTCAACGTCTGGCTCAACGGTCAGCCC
AACGGTGGCAGGCATGGCTACCTGCCTGGCCAGTGGCCGCGATTCTGGACGTTGGTCTGCCCGCTGCTGTCCCCC
GGTTTGCCTGCTGACGTGCTGGCAGAGAGTCGGTTCAGGGCTGGCAAGGTTACGTCAGGGTCGACGGCAAGGCCT
TCAACTGGATGGGCGACGCCCCTGTCAAGGCCCCCAATGTCGATCAGGTCTCCCTCGAGTACACGTCCACCAAGA
CGACATTTATCATGAATGTCGACGGCAAGGTTCAGCTCAAGGCCGAGTTTCTGTCCCCCGTCTATCCCGACGATC
TGCGCCGCCAGTCCATCACCTCGTCCTACCTCCAGGTTTCTGCCAGATCCCTGGATGGTCGACCTCACAACGTTC
AGATCTACTGTGACGTCTCCGGCGGTGAGTCGTATTTCCTTTTCCCTGCCCCTTGATCCCCTGCCCACTAACCCA
ATCCAGAATGGGCTTCGGGCGATACCAGTGCCGTCATCCAGTGGGAGAGCGGCACGAGGGACAATGTGCGCTATC
ACAAGTTTCACCGCAAGGACCAGCAGGTTTTCAAGGACATCAATGAGATCGCCTCGTGGGGCAACTGGTACTGGG
CCACCGGTAACCAGGTACGTCGCACCGGCATCCCTGCTCAAGTGCCGTAGCTGATGACGGCTCGGGAATAGGACG
GTGTCACTACCGAGATCGGCGCCGACAACTATGTCCGCAACATGTTTGTCAGGGATGGCCGCCTCCGGGATCAGG
TCGACCCCAAGCATCGCGCCATCCGCGACAACTGGTGAGCCCCTCGTGTCAAGCAAGTATACTCCAGCTAACAAG
ATAGGCCCGTCTTTGCCTTTGCCAGGGATCTCAAGGACGTCACCGGCAGCTGGAAGGACACCCTCTTCACCATCG
GCTACACGCAGGACGACGCCATCAACTTCCAGGGCAAGGAGGCCCAGCCCCGCGCCGTGCCGTCCCTGTGGAGGA
GCTTCCACCGCGAGGACCAGCTCGTCAGCATCTTTTACAAGGACTACAACTATGCCGTCCAGTACTCGAGGTCCC
TCGACGACCGCATCAACCGCGACTCGCAGGCGGTGGCGGGCTCGGCTGGCAAGAACTATGCCACCATGACGACGC
TGGCCGTCCGCCAGGTCTTTGGCGCCCTCGGCTTCACCGGCACCCAGCAGCAGCCGCTCGTCTTCCTCAAGGAAA
TCAGCTCCAACAGCGACATCCAGACCGTCGACGTCATCTTCCCGGCCTTCCCCATCCTGCTCTACCTCAACCCCG
ACCTGCTGCGCTACATGCTGGACCCCCTGCTGGAGAATGGCCGCACGCACTACCCCAACAACTACGCCCAGCACG
ACCTCGGCCGCTATCCCGTCGCCCTGGGCCATCCCAAGGGCGACGACGAGCAGATGCCGCTGGAGGAGTGCGGCA
ACATGGTCATCATGATGCTCGCGTACGCCCAGCGGAAGCGCGACAATGGTTATCTGGCGGCCAACTGGGACCTGC
TGGATAAGTGGGCGCAGTACCTGGTTCAGGACGCCAAGATTCCGGCCAACCAGCTGTCGACGGACGACTTTGCTG
GTCATCTTGCGTGAGTCTCTCGTCATGTCGCATGTCGCCTCGCATCTGACACCCCGTAGCAACCAGACGAACCTG
GCCCTCAAGGGCATCATCGCCCTCGAAGCCATGTCGCGCATCGCCGGCTCGACCGGTCACGCCGAACAGCAAAAG
AGGTACGGCGACACGGCTCGAGACTATCTCAGGTTCTGGCAGCAGCACGCCATCAACACCAGGGCCAACCCGAGG
CACACGATGCTGCAATACGACAGCCCCGACTCTTACGGTTGGTTCCCCTTGCGCAAAGACGACGCCCGCTGACGC
TCGCAGGCCTGCTGTACAACATTTACTCGGACAAGGTGCTCAACCTCAACTTTGTCCCGCAATCCGTCTACGACA
TGCAGAGCGACTTTTACCTCAGCGTCCAGAAGCGCTTCGGCGTCATCCTCGACACGCGCGGCACCCTGACCAAGC
TCGACTGGGAGATGTTTTCGGCCGCCGTGGCCAAGGAGCCCACGCGCAACATGTTTATCAACAAGATTGCCGACT
GGATCAACCAGACGCCCACCTGGCGGGCCTTTACCGACCTGTACGACACGGGGTCGGGCGGATACCCGTCGGCCG
GACTGCAGTTTACGGCGCGACCGGTCCAGGGCGGCGTCTTTTCCCTGCTGGCGCTGCGGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail