Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5899
Gene name
LocationContig_608:7528..9372
Strand+
Gene length (bp)1844
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.1E-30 23 304
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-08 54 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 11 530 2.0E-55
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 1 481 5.0E-41
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 12 458 3.0E-40
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 6 458 9.0E-38
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 17 164 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 11 530 2.0E-55
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 1 481 5.0E-41
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 12 458 3.0E-40
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 6 458 9.0E-38
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 17 164 6.0E-11
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 33 173 2.0E-10
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 18 173 4.0E-10
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 33 176 2.0E-08
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 33 176 2.0E-08
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 33 176 2.0E-08
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 33 176 2.0E-08
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 33 176 2.0E-08
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 33 176 2.0E-08
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 33 176 4.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 12 165 1.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 3 175 2.0E-07
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 56 165 2.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 3 175 2.0E-07
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 33 222 2.0E-07
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 33 222 2.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 3 175 2.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 3 175 2.0E-07
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 3 175 2.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 6 176 3.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 33 173 9.0E-07
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 33 173 1.0E-06
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 56 162 2.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 42 166 2.0E-06
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 3 175 2.0E-06
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 28 175 3.0E-06
sp|P39843|BMR2_BACSU Multidrug resistance protein 2 OS=Bacillus subtilis (strain 168) GN=blt PE=3 SV=1 56 219 5.0E-06
sp|P58120|PMRA_LACLA Multi-drug resistance efflux pump PmrA homolog OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pmrA PE=3 SV=1 29 182 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 85 104 19
3 109 131 22
4 143 165 22
5 187 209 22
6 278 295 17
7 332 354 22
8 366 384 18
9 394 416 22
10 423 445 22
11 460 482 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5899
MTDSARPQPKLPVQQLVILVVARLAEPLAYTSIYPYLPEMISDFGIPQVDIARWAGLITAVFAVSQGLAAVPWGR
ASDRYGRKPVVLFGLASTMICFIVWGLSTSLTMAIIARAVQGAGSGNVAIIRTIVAEIVPVKELQPRAFSIMPLV
WSIGSVVGPAFGGFFAQPATKYPDWFGNINFFHRFPYALPNLIASAFFLFSATTTFLFLQESLSSKRGQRDIGLT
LGRRLTHLFTRKSKPPRPSDAESPPDQEHLIPSQKLAAPEPPPGIKEAFTRQTVISLVAYTFTSMHSVAFDQNVT
VFLNYPVMEHTPENTQLPFFFNGGFGLKSGKIGIIFAIYGTTCGLIQFFLYPPLCKRFGILKCWQFCSIAMPFIY
IITPYASLFPTQQSRLTAMVLVLMLKGLVGIIAFPCITILFTNSCSSTRILGTVNGFATAFSGFARAIGPAATGY
TFTWGVRHGCIAAAYYFLAIVAFVGAIPGFMVEEGDGPTRSEADFAEDAAADHEEERNSENTPLLTDASRSYGAH
QARQRSVQGDARQA*
Coding >Ophun1|5899
ATGACGGACTCGGCGCGGCCGCAGCCCAAGCTGCCCGTCCAACAGCTCGTCATCCTAGTCGTCGCCCGGCTCGCC
GAACCGCTGGCATACACCTCCATCTACCCGTACCTCCCCGAGATGATCAGCGACTTTGGCATCCCGCAGGTGGAC
ATTGCCCGCTGGGCCGGCCTCATCACCGCCGTCTTCGCCGTCAGTCAGGGTCTGGCTGCCGTTCCGTGGGGGCGG
GCTTCGGATCGGTATGGGAGGAAGCCGGTTGTTTTGTTTGGTCTTGCTAGTACCATGATCTGCTTTATTGTTTGG
GGCTTGTCGACGAGCTTGACCATGGCTATCATTGCGCGCGCCGTTCAGGGAGCTGGCAGTGGAAACGTCGCCATC
ATCAGAACCATCGTAGCAGAAATCGTCCCCGTCAAGGAACTCCAGCCCAGAGCCTTCTCCATCATGCCGCTGGTA
TGGTCCATCGGCTCCGTCGTCGGCCCTGCATTCGGCGGCTTCTTCGCCCAGCCAGCAACCAAGTATCCAGACTGG
TTCGGCAACATCAACTTCTTCCATCGCTTCCCCTACGCCCTCCCCAACCTCATCGCCAGCGCCTTCTTCCTCTTC
TCCGCCACCACAACCTTTCTCTTCCTCCAGGAATCCCTCTCATCCAAGCGCGGCCAACGTGACATAGGCCTCACT
CTAGGCCGTCGCCTCACCCACCTCTTCACCCGAAAGTCCAAACCACCCCGTCCCTCAGACGCCGAGTCCCCCCCA
GATCAAGAGCATCTCATCCCCTCACAGAAGCTAGCAGCGCCGGAACCCCCGCCGGGCATCAAGGAGGCCTTTACC
CGACAGACGGTCATCAGCCTCGTGGCCTATACCTTTACCTCGATGCACTCGGTTGCCTTTGATCAGAACGTCACC
GTCTTTCTCAACTACCCCGTCATGGAGCACACGCCTGAAAACACGCAGCTGCCGTTCTTCTTCAACGGCGGGTTC
GGCCTCAAGTCGGGTAAGATTGGCATCATCTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAGTTCTTCCTA
TATCCTCCCCTATGCAAACGCTTCGGCATTTTGAAATGCTGGCAGTTTTGCTCCATCGCAATGCCCTTCATCTAC
ATCATAACCCCCTACGCCTCCCTCTTCCCCACACAACAAAGCCGCCTCACAGCAATGGTCCTCGTCCTAATGCTC
AAAGGGCTAGTCGGCATAATCGCCTTCCCCTGCATAACAATCCTCTTCACAAACTCGTGCTCCTCAACCCGCATC
CTGGGAACGGTAAACGGCTTCGCCACCGCCTTCAGCGGCTTCGCCCGCGCCATCGGTCCGGCTGCCACCGGCTAC
ACCTTCACCTGGGGCGTGAGACACGGCTGCATCGCCGCGGCGTATTACTTCCTTGCCATTGTTGCTTTCGTCGGT
GCTATTCCTGGGTTCATGGTTGAGGAGGGGGATGGGCCGACGAGGTCGGAGGCTGACTTTGCTGAGGACGCTGCT
GCGGATCACGAAGAGGAGAGGAATAGCGAGAATACCCCGTTGCTGACGGATGCCTCTCGAAGCTACGGGGCGCAT
CAGGCTCGTCAGAGGTCCGTTCAGGGCGACGCTCGACAAGCTTGA
Transcript >Ophun1|5899
ATGACGGACTCGGCGCGGCCGCAGCCCAAGCTGCCCGTCCAACAGCTCGTCATCCTAGTCGTCGCCCGGCTCGCC
GAACCGCTGGCATACACCTCCATCTACCCGTACCTCCCCGAGATGATCAGCGACTTTGGCATCCCGCAGGTGGAC
ATTGCCCGCTGGGCCGGCCTCATCACCGCCGTCTTCGCCGTCAGTCAGGGTCTGGCTGCCGTTCCGTGGGGGCGG
GCTTCGGATCGGTATGGGAGGAAGCCGGTTGTTTTGTTTGGTCTTGCTAGTACCATGATCTGCTTTATTGTTTGG
GGCTTGTCGACGAGCTTGACCATGGCTATCATTGCGCGCGCCGTTCAGGGAGCTGGCAGTGGAAACGTCGCCATC
ATCAGAACCATCGTAGCAGAAATCGTCCCCGTCAAGGAACTCCAGCCCAGAGCCTTCTCCATCATGCCGCTGGTA
TGGTCCATCGGCTCCGTCGTCGGCCCTGCATTCGGCGGCTTCTTCGCCCAGCCAGCAACCAAGTATCCAGACTGG
TTCGGCAACATCAACTTCTTCCATCGCTTCCCCTACGCCCTCCCCAACCTCATCGCCAGCGCCTTCTTCCTCTTC
TCCGCCACCACAACCTTTCTCTTCCTCCAGGAATCCCTCTCATCCAAGCGCGGCCAACGTGACATAGGCCTCACT
CTAGGCCGTCGCCTCACCCACCTCTTCACCCGAAAGTCCAAACCACCCCGTCCCTCAGACGCCGAGTCCCCCCCA
GATCAAGAGCATCTCATCCCCTCACAGAAGCTAGCAGCGCCGGAACCCCCGCCGGGCATCAAGGAGGCCTTTACC
CGACAGACGGTCATCAGCCTCGTGGCCTATACCTTTACCTCGATGCACTCGGTTGCCTTTGATCAGAACGTCACC
GTCTTTCTCAACTACCCCGTCATGGAGCACACGCCTGAAAACACGCAGCTGCCGTTCTTCTTCAACGGCGGGTTC
GGCCTCAAGTCGGGTAAGATTGGCATCATCTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAGTTCTTCCTA
TATCCTCCCCTATGCAAACGCTTCGGCATTTTGAAATGCTGGCAGTTTTGCTCCATCGCAATGCCCTTCATCTAC
ATCATAACCCCCTACGCCTCCCTCTTCCCCACACAACAAAGCCGCCTCACAGCAATGGTCCTCGTCCTAATGCTC
AAAGGGCTAGTCGGCATAATCGCCTTCCCCTGCATAACAATCCTCTTCACAAACTCGTGCTCCTCAACCCGCATC
CTGGGAACGGTAAACGGCTTCGCCACCGCCTTCAGCGGCTTCGCCCGCGCCATCGGTCCGGCTGCCACCGGCTAC
ACCTTCACCTGGGGCGTGAGACACGGCTGCATCGCCGCGGCGTATTACTTCCTTGCCATTGTTGCTTTCGTCGGT
GCTATTCCTGGGTTCATGGTTGAGGAGGGGGATGGGCCGACGAGGTCGGAGGCTGACTTTGCTGAGGACGCTGCT
GCGGATCACGAAGAGGAGAGGAATAGCGAGAATACCCCGTTGCTGACGGATGCCTCTCGAAGCTACGGGGCGCAT
CAGGCTCGTCAGAGGTCCGTTCAGGGCGACGCTCGACAAGCTTGA
Gene >Ophun1|5899
ATGACGGACTCGGCGCGGCCGCAGCCCAAGCTGCCCGTCCAACAGCTCGTCATCCTAGGTCCGTCCCCTGACAAC
CATCCAGCACAACCCCCCATCCTAACCCCCATCCCTCCACAGTCGTCGCCCGGCTCGCCGAACCGCTGGCATACA
CCTCCATCTACCCGTACCTCCCCGAGATGATCAGCGACTTTGGCATCCCGCAGGTGGACATTGCCCGCTGGGCCG
GCCTCATCACCGCCGTCTTCGCCGTCAGTCAGGGTCTGGCTGCCGTTCCGTGGGGGCGGGCTTCGGATCGGTATG
GGAGGAAGCCGGTTGTTTTGTTTGGTCTTGCTAGTACCATGATCTGCTTTATTGTTTGGGGCTTGTCGACGAGCT
TGACCATGGCTATCATTGCGCGCGCCGTTCAGGGAGCTGGCAGTGGAAACGGTAACCTCACCACCAGCTTTCTAC
TCTCCATATCAGCATCATCTCCGCTGACAATGACCCAGTCGCCATCATCAGAACCATCGTAGCAGAAATCGTCCC
CGTCAAGGAACTCCAGCCCAGAGCCTTCTCCATCATGCCGCTGGTATGGTCCATCGGCTCCGTCGTCGGCCCTGC
ATTCGGCGGCTTCTTCGCCCAGCCAGCAACCAAGTATCCAGACTGGTTCGGCAACATCAACTTCTTCCATCGCTT
CCCCTACGCCCTCCCCAACCTCATCGCCAGCGCCTTCTTCCTCTTCTCCGCCACCACAACCTTTCTCTTCCTCCA
GGTACGCCATCCCCTTCCCTCAGAAGGCACCCGATAGTTAACACTCCCAAGGAATCCCTCTCATCCAAGCGCGGC
CAACGTGACATAGGCCTCACTCTAGGCCGTCGCCTCACCCACCTCTTCACCCGAAAGTCCAAACCACCCCGTCCC
TCAGACGCCGAGTCCCCCCCAGATCAAGAGCATCTCATCCCCTCACAGAAGCTAGCAGCGCCGGAACCCCCGCCG
GGCATCAAGGAGGCCTTTACCCGACAGACGGTCATCAGCCTCGTGGCCTATACCTTTACCTCGATGCACTCGGTT
GCCTTTGATCAGAACGTCACCGTCTTTCTCAACTACCCCGTCATGGAGCACACGCCTGAAAACACGCAGCTGCCG
TTCTTCTTCAACGGCGGGTTCGGCCTCAAGTCGGGTAAGATTGGCATCATCTTTGCCATCTACGGCACCACCTGC
GGCCTCATCCAGTTCTTCCTATATCCTCCCCTATGCAAACGCTTCGGCATTTTGAAATGCTGGCAGTTTTGCTGT
ACGTCTCCCCCCTTTCTCTCAGAAGACCCCCGACTGATACAACAACCCAAGCCATCGCAATGCCCTTCATCTACA
TCATAACCCCCTACGCCTCCCTCTTCCCCACACAACAAAGCCGCCTCACAGCAATGGTCCTCGTCCTAATGCTCA
AAGGGCTAGTCGGCATAATCGCCTTCCCCTGCATAACAATCCTCTTCACAAACTCGTGCTCCTCAACCCGCATCC
TGGGAACGGTAAACGGCTTCGCCACCGCCTTCAGCGGCTTCGCCCGCGCCATCGGTCCGGCTGCCACCGGCTACA
CCTTCACCTGGGGCGTGAGACACGGCTGCATCGCCGCGGCGTATTACTTCCTTGCCATTGTTGCTTTCGTCGGTG
CTATTCCTGGGTTCATGGTTGAGGAGGGGGATGGGCCGACGAGGTCGGAGGCTGACTTTGCTGAGGACGCTGCTG
CGGATCACGAAGAGGAGAGGAATAGCGAGAATACCCCGTTGCTGACGGATGCCTCTCGAAGCTACGGGGCGCATC
AGGCTCGTCAGAGGTCCGTTCAGGGCGACGCTCGACAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail