Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5898
Gene name
LocationContig_608:3898..6428
Strand-
Gene length (bp)2530
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 6.0E-20 388 574
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 5.5E-17 655 772
PF02225 PA PA domain 2.4E-05 195 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 71 771 0.0E+00
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 25 764 2.0E-106
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 77 743 3.0E-105
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 36 773 1.0E-103
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 77 743 2.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 71 771 0.0E+00
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 25 764 2.0E-106
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 77 743 3.0E-105
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 36 773 1.0E-103
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 77 743 2.0E-100
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 36 743 9.0E-100
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 26 743 2.0E-99
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 84 743 5.0E-98
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 44 776 9.0E-81
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 185 776 2.0E-74
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 185 776 7.0E-74
sp|Q9UQQ1|NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=1 SV=2 59 776 9.0E-74
sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis elegans GN=R57.1 PE=1 SV=2 48 627 1.0E-68
sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis briggsae GN=CBG08178 PE=3 SV=1 61 627 8.0E-68
sp|Q9HBA9|FOH1B_HUMAN Putative N-acetylated-alpha-linked acidic dipeptidase OS=Homo sapiens GN=FOLH1B PE=2 SV=1 360 743 5.0E-61
sp|O43023|YGV9_SCHPO Inactive zinc metalloprotease C354.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.09c PE=3 SV=1 22 756 5.0E-54
sp|B2GUY2|TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus GN=Tfr2 PE=2 SV=1 159 626 5.0E-52
sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus GN=Tfr2 PE=1 SV=2 164 626 8.0E-51
sp|Q9UP52|TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens GN=TFR2 PE=1 SV=1 188 626 7.0E-48
sp|Q99376|TFR1_RAT Transferrin receptor protein 1 (Fragment) OS=Rattus norvegicus GN=Tfrc PE=2 SV=1 187 628 7.0E-36
sp|Q9GLD3|TFR1_CANLF Transferrin receptor protein 1 OS=Canis lupus familiaris GN=TFRC PE=1 SV=1 187 623 1.0E-35
sp|Q2V905|TFR1_HORSE Transferrin receptor protein 1 OS=Equus caballus GN=TFRC PE=2 SV=1 187 628 3.0E-35
sp|Q9MYZ3|TFR1_FELCA Transferrin receptor protein 1 OS=Felis catus GN=TFRC PE=1 SV=1 187 626 3.0E-34
sp|Q5RDH6|TFR1_PONAB Transferrin receptor protein 1 OS=Pongo abelii GN=TFRC PE=2 SV=1 187 623 1.0E-33
sp|Q8HZV3|TFR1_PIG Transferrin receptor protein 1 OS=Sus scrofa GN=TFRC PE=2 SV=1 187 628 7.0E-33
sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 187 623 1.0E-32
sp|Q07891|TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus GN=TFRC PE=2 SV=1 187 628 8.0E-32
sp|Q90997|TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus GN=TFRC PE=2 SV=2 188 582 2.0E-31
sp|Q62351|TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus GN=Tfrc PE=1 SV=1 187 628 2.0E-30
sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3 184 616 4.0E-23
sp|Q9HZQ8|LAP_PSEAE Aminopeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lap PE=1 SV=1 384 485 1.0E-07
sp|Q02PA2|LAP_PSEAB Aminopeptidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lap PE=1 SV=1 384 485 1.0E-07
sp|Q08693|TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE2 PE=1 SV=1 184 489 2.0E-06
sp|P80561|APX_STRGG Aminopeptidase S OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_5809 PE=1 SV=2 387 530 3.0E-06
sp|P81715|LIE1_STREX Leupeptin-inactivating enzyme 1 OS=Streptomyces exfoliatus GN=lieA PE=1 SV=2 387 551 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5898
MARQSESTPLIQTVQIGPRPRRYPHQTCRRFCTIACASILTTGFLYFLIHAFFVWPHRHHHDPQSRYSLAGRKSL
SHERLKSILLDTPSAEKAKEWSRYYTSGPHLAGKNYSQAEWTMDKWLGWGVQASIASYDTYINYPVDHSLALLNR
TDKSGSWEVAFTASLEEDILKDDPTTALNTRIPTFHGYSASGNATASFVYVNYGTHLDFEDLIEADVALGGHIAV
ARYGGVFRGLIVKRAQELGMVAVVIYSDPGDDGEMTVENGYEAYPKGPARNPSSVQRGSVQFLSIRPGDPSTPGY
PSKPGVPRAPVDDAIPSIPSLPISYADAIPILKALNGHGPKAASLGPRWKANVGLGYKGVEYNIGPSPSTVKLKL
SNEQDYTITPLWNVIGVVNGSMPHQVLVVGNHRDAWIAGGAADPNSGSAVLNELVRGVGKAVEAGWKPLRTIVFA
SWDGEEYGLIGSTEWVEEYLPWLSEANVAYLNVDIGAAGPELRASAAPLLHQILRDATQAVPSPNQTVEGQTLGD
VWNGHISTIGSGSDFTAFQDFAGIPCIDVSFKNSQDSPVYHYHSNYDSFHWMETYGDVGFRYHVAMARLLGILVA
ELSNSIVLPFGAADYADALTSYLGKVRHKLHAPLPNPSSTTEPANGTATALDAALDTLAHSLAELRVRSAGLDGR
AAWANARLEEGTPWWDVIGKIRLWITIANVNAQYKFLERSFLFEGGLDGRSWFKHVVFAPGLWTGYAGGLMESID
ARDYNNGLKWAAIIDRCVWRAIRGVE*
Coding >Ophun1|5898
ATGGCCCGTCAGTCCGAGTCTACGCCCCTGATCCAGACGGTTCAGATCGGTCCGAGGCCGAGGCGCTATCCCCAT
CAGACGTGTCGCCGCTTCTGCACCATTGCCTGCGCATCGATTCTCACTACCGGCTTCTTGTATTTCCTGATTCAT
GCTTTCTTCGTGTGGCCTCATCGTCATCATCATGATCCGCAGAGTCGCTATTCTCTGGCTGGGAGGAAGTCTCTT
AGCCATGAGAGGCTCAAGTCGATATTGCTCGATACCCCTTCGGCGGAAAAAGCAAAGGAATGGAGTCGATACTAC
ACGTCTGGGCCCCATCTCGCCGGCAAGAATTACTCTCAGGCGGAGTGGACCATGGATAAGTGGCTGGGCTGGGGC
GTGCAGGCGAGCATCGCTTCTTACGACACTTACATCAACTACCCCGTCGACCACAGCCTCGCCCTACTGAACCGC
ACCGACAAGTCCGGCTCGTGGGAGGTGGCCTTCACGGCATCGCTGGAGGAGGATATCCTCAAAGACGATCCGACG
ACGGCACTCAACACCCGGATCCCCACCTTTCACGGCTACTCTGCCAGCGGAAACGCCACGGCCTCGTTCGTCTAC
GTCAACTACGGCACGCACCTAGACTTTGAGGATCTTATCGAGGCTGACGTCGCGCTTGGGGGTCATATCGCCGTC
GCTCGTTATGGCGGTGTCTTTCGCGGGCTGATTGTCAAGCGCGCGCAGGAGCTTGGCATGGTGGCTGTCGTTATA
TACAGCGATCCCGGCGATGATGGGGAGATGACGGTTGAGAATGGTTACGAGGCTTATCCGAAAGGGCCGGCGCGC
AATCCTTCAAGTGTGCAGCGTGGGAGCGTGCAGTTCCTCAGCATTCGGCCGGGAGATCCATCTACACCCGGATAT
CCCTCCAAGCCGGGCGTCCCCCGTGCACCAGTCGACGACGCCATACCGTCCATCCCCTCACTCCCCATCTCCTAC
GCCGACGCCATCCCCATCCTCAAAGCCCTCAACGGCCATGGCCCCAAAGCCGCCTCCCTCGGCCCCCGCTGGAAA
GCAAACGTCGGTCTCGGCTACAAAGGCGTCGAGTATAATATCGGCCCCTCGCCCAGCACCGTGAAGCTCAAGCTC
TCAAACGAGCAGGACTACACAATCACCCCTCTTTGGAACGTCATCGGCGTCGTCAACGGGTCCATGCCGCACCAG
GTTCTCGTCGTCGGCAACCATCGGGACGCGTGGATCGCGGGCGGAGCTGCAGATCCCAATAGCGGCTCTGCTGTT
CTCAACGAGCTGGTTCGCGGCGTGGGCAAGGCCGTTGAGGCTGGGTGGAAGCCGTTGCGGACCATTGTCTTTGCC
AGCTGGGATGGTGAAGAGTATGGACTCATCGGGAGCACGGAATGGGTGGAGGAGTATCTCCCCTGGCTCTCTGAA
GCCAACGTCGCCTACCTCAACGTCGACATCGGCGCAGCCGGACCCGAACTCAGAGCTTCAGCCGCGCCGCTTCTT
CACCAGATCCTTCGCGACGCAACGCAAGCGGTGCCATCTCCCAACCAGACGGTCGAGGGCCAGACGCTGGGCGAT
GTCTGGAACGGCCACATCAGCACCATAGGCAGCGGCAGTGACTTCACCGCCTTCCAGGACTTTGCCGGCATTCCC
TGCATCGACGTCTCCTTCAAGAACAGCCAAGACTCGCCCGTCTATCACTACCACAGCAACTACGACAGCTTCCAC
TGGATGGAAACGTACGGCGACGTTGGTTTCCGCTACCACGTCGCCATGGCCCGTCTGCTAGGCATCCTCGTAGCA
GAACTAAGCAACAGCATCGTCCTCCCCTTCGGAGCAGCCGATTACGCCGACGCCTTGACAAGCTACCTCGGCAAA
GTCCGTCACAAACTCCACGCCCCCCTCCCCAACCCATCGTCAACCACCGAGCCAGCAAACGGCACCGCCACCGCC
CTCGACGCCGCCCTCGACACCCTCGCCCACTCCCTCGCAGAGCTCCGCGTCCGCTCGGCGGGCCTCGACGGGAGA
GCCGCCTGGGCCAACGCGCGGCTGGAGGAGGGGACGCCCTGGTGGGACGTCATCGGCAAGATCCGCCTGTGGATC
ACGATTGCGAATGTCAACGCCCAGTACAAGTTCCTGGAGAGGAGCTTTTTGTTCGAGGGCGGGTTGGATGGTCGG
AGTTGGTTTAAGCATGTTGTTTTTGCGCCTGGGCTTTGGACTGGCTATGCTGGAGGCTTGATGGAGAGTATCGAT
GCGAGGGATTATAATAATGGGTTGAAGTGGGCTGCTATCATCGACCGGTGTGTCTGGCGCGCGATCCGCGGTGTT
GAGTGA
Transcript >Ophun1|5898
ATGGCCCGTCAGTCCGAGTCTACGCCCCTGATCCAGACGGTTCAGATCGGTCCGAGGCCGAGGCGCTATCCCCAT
CAGACGTGTCGCCGCTTCTGCACCATTGCCTGCGCATCGATTCTCACTACCGGCTTCTTGTATTTCCTGATTCAT
GCTTTCTTCGTGTGGCCTCATCGTCATCATCATGATCCGCAGAGTCGCTATTCTCTGGCTGGGAGGAAGTCTCTT
AGCCATGAGAGGCTCAAGTCGATATTGCTCGATACCCCTTCGGCGGAAAAAGCAAAGGAATGGAGTCGATACTAC
ACGTCTGGGCCCCATCTCGCCGGCAAGAATTACTCTCAGGCGGAGTGGACCATGGATAAGTGGCTGGGCTGGGGC
GTGCAGGCGAGCATCGCTTCTTACGACACTTACATCAACTACCCCGTCGACCACAGCCTCGCCCTACTGAACCGC
ACCGACAAGTCCGGCTCGTGGGAGGTGGCCTTCACGGCATCGCTGGAGGAGGATATCCTCAAAGACGATCCGACG
ACGGCACTCAACACCCGGATCCCCACCTTTCACGGCTACTCTGCCAGCGGAAACGCCACGGCCTCGTTCGTCTAC
GTCAACTACGGCACGCACCTAGACTTTGAGGATCTTATCGAGGCTGACGTCGCGCTTGGGGGTCATATCGCCGTC
GCTCGTTATGGCGGTGTCTTTCGCGGGCTGATTGTCAAGCGCGCGCAGGAGCTTGGCATGGTGGCTGTCGTTATA
TACAGCGATCCCGGCGATGATGGGGAGATGACGGTTGAGAATGGTTACGAGGCTTATCCGAAAGGGCCGGCGCGC
AATCCTTCAAGTGTGCAGCGTGGGAGCGTGCAGTTCCTCAGCATTCGGCCGGGAGATCCATCTACACCCGGATAT
CCCTCCAAGCCGGGCGTCCCCCGTGCACCAGTCGACGACGCCATACCGTCCATCCCCTCACTCCCCATCTCCTAC
GCCGACGCCATCCCCATCCTCAAAGCCCTCAACGGCCATGGCCCCAAAGCCGCCTCCCTCGGCCCCCGCTGGAAA
GCAAACGTCGGTCTCGGCTACAAAGGCGTCGAGTATAATATCGGCCCCTCGCCCAGCACCGTGAAGCTCAAGCTC
TCAAACGAGCAGGACTACACAATCACCCCTCTTTGGAACGTCATCGGCGTCGTCAACGGGTCCATGCCGCACCAG
GTTCTCGTCGTCGGCAACCATCGGGACGCGTGGATCGCGGGCGGAGCTGCAGATCCCAATAGCGGCTCTGCTGTT
CTCAACGAGCTGGTTCGCGGCGTGGGCAAGGCCGTTGAGGCTGGGTGGAAGCCGTTGCGGACCATTGTCTTTGCC
AGCTGGGATGGTGAAGAGTATGGACTCATCGGGAGCACGGAATGGGTGGAGGAGTATCTCCCCTGGCTCTCTGAA
GCCAACGTCGCCTACCTCAACGTCGACATCGGCGCAGCCGGACCCGAACTCAGAGCTTCAGCCGCGCCGCTTCTT
CACCAGATCCTTCGCGACGCAACGCAAGCGGTGCCATCTCCCAACCAGACGGTCGAGGGCCAGACGCTGGGCGAT
GTCTGGAACGGCCACATCAGCACCATAGGCAGCGGCAGTGACTTCACCGCCTTCCAGGACTTTGCCGGCATTCCC
TGCATCGACGTCTCCTTCAAGAACAGCCAAGACTCGCCCGTCTATCACTACCACAGCAACTACGACAGCTTCCAC
TGGATGGAAACGTACGGCGACGTTGGTTTCCGCTACCACGTCGCCATGGCCCGTCTGCTAGGCATCCTCGTAGCA
GAACTAAGCAACAGCATCGTCCTCCCCTTCGGAGCAGCCGATTACGCCGACGCCTTGACAAGCTACCTCGGCAAA
GTCCGTCACAAACTCCACGCCCCCCTCCCCAACCCATCGTCAACCACCGAGCCAGCAAACGGCACCGCCACCGCC
CTCGACGCCGCCCTCGACACCCTCGCCCACTCCCTCGCAGAGCTCCGCGTCCGCTCGGCGGGCCTCGACGGGAGA
GCCGCCTGGGCCAACGCGCGGCTGGAGGAGGGGACGCCCTGGTGGGACGTCATCGGCAAGATCCGCCTGTGGATC
ACGATTGCGAATGTCAACGCCCAGTACAAGTTCCTGGAGAGGAGCTTTTTGTTCGAGGGCGGGTTGGATGGTCGG
AGTTGGTTTAAGCATGTTGTTTTTGCGCCTGGGCTTTGGACTGGCTATGCTGGAGGCTTGATGGAGAGTATCGAT
GCGAGGGATTATAATAATGGGTTGAAGTGGGCTGCTATCATCGACCGGTGTGTCTGGCGCGCGATCCGCGGTGTT
GAGTGA
Gene >Ophun1|5898
ATGGCCCGTCAGTCCGAGTCTACGCCCCTGATCCAGACGGTTCAGATCGGTCCGAGGCCGAGGCGCTATCCCCAT
CAGACGTGTCGCCGCTTCTGCACCATTGCCTGCGCATCGATTCTCACTACCGGCTTCTTGTATTTCCTGATTCAT
GCTTTCTTCGTGTGGCCTCATCGTCATCATCATGATCCGCAGAGTCGCTATTCTCTGGCTGGGAGGAAGTCTCTT
AGCCATGAGAGGCTCAAGTCGATATTGCTCGATACCCCTTCGGCGGAAAAAGCAAAGGAATGGAGTCGATACTAC
ACGTCTGGGCCCCATCTCGCCGGCAAGAATTACTCTCAGGTATGACACCTCCCACCAAAAACCAGCCTGCCGCTG
ACAGTCGCAGGCGGAGTGGACCATGGATAAGTGGCTGGGCTGGGGCGTGCAGGCGAGCATCGCTTCTTACGACAC
TTACATCAACTACCCCGTCGACCACAGCCTCGCCCTACTGAACCGCACCGACAAGTCCGGCTCGTGGGAGGTGGC
CTTCACGGCATCGCTGGAGGAGGATATCCTCAAAGACGATCCGACGACGGCACTCAACACCCGGATCCCCACCTT
TCACGGCTACTCTGCCAGCGGAAACGCCACGGCCTCGTTCGTCTACGTCAACTACGGCACGCACCTAGACTTTGA
GGATCTTATCGAGGCTGACGTCGCGCTTGGGGGTCATATCGCCGTCGCTCGTTATGGCGGTGTCTTTCGCGGGCT
GATTGTCAAGCGCGCGCAGGAGCTTGGCATGGTGGCTGTCGTTATATACAGCGATCCCGGCGATGATGGGGAGAT
GACGGTTGAGAATGGTTACGAGGCTTATCCGAAAGGGCCGGCGCGCAATCCTTCAAGTGTGCAGCGTGGGAGCGT
GCAGTTCCTCAGCATTCGGCCGGGAGATCCGTGCGTTTCTCTCCCGTCTTGCGAGGTGGTGGACAGCCGTGGGGA
CTTGCTGAACCGTTGAGACTGCAGATCTACACCCGGATATCCCTCCAAGCCGGGCGTCCCCCGTGCACCAGTCGA
CGACGCCATACCGTCCATCCCCTCACTCCCCATCTCCTACGCCGACGCCATCCCCATCCTCAAAGCCCTCAACGG
CCATGGCCCCAAAGCCGCCTCCCTCGGCCCCCGCTGGAAAGCAAACGTCGGTCTCGGCTACAAAGGCGTCGAGTA
TAATATCGGCCCCTCGCCCAGCACCGTGAAGCTCAAGCTCTCAAACGAGCAGGACTACACAATCACCCCTCTTTG
GAACGTCATCGGCGTCGTCAACGGGTCCATGCCGCACCAGGTTCTCGTCGTCGGCAACCATCGGGACGCGTGGAT
CGCGGGCGGAGCTGCAGATCCCAATAGCGGCTCTGCTGTTCTCAACGAGCTGGTTCGCGGCGTGGGCAAGGCCGT
TGAGGCTGGGTGGAAGCCGTTGCGGACCATTGTCTTTGCCAGCTGGGATGGTGAAGAGTATGGACTCATCGGGAG
CACGGAATGGGTGGAGGAGTATCTCCCCTGGCTCTCTGAAGCCAACGTCGCCTACCTCAACGTCGACATCGGCGC
AGCCGGACCCGAACTCAGAGCTTCAGCCGCGCCGCTTCTTCACCAGATCCTTCGCGACGCAACGCAAGCGGTGCC
ATCTCCCAACCAGACGGTCGAGGGCCAGACGCTGGGCGATGTCTGGAACGGCCACATCAGCACCATAGGCAGCGG
CAGTGACTTCACCGCCTTCCAGGACTTTGCCGGCATTCCCTGCATCGACGTCTCCTTCAAGAACAGCCAAGACTC
GCCCGTCTATCACTACCACAGCAACTACGACAGCTTCCACTGGATGGAAACGTACGGCGACGTTGGTTTCCGCTA
CCACGTCGCCATGGCCCGTCTGCTAGGCATCCTCGTAGCAGAACTAAGCAACAGCATCGTCCTCCCCTTCGGAGC
AGCCGATTACGCCGACGCCTTGACAAGCTACCTCGGCAAAGTCCGTCACAAACTCCACGCCCCCCTCCCCAACCC
ATCGTCAACCACCGAGCCAGCAAACGGCACCGCCACCGCCCTCGACGCCGCCCTCGACACCCTCGCCCACTCCCT
CGCAGAGCTCCGCGTCCGCTCGGCGGGCCTCGACGGGAGAGCCGCCTGGGCCAACGCGCGGCTGGAGGAGGGGAC
GCCCTGGTGGGACGTCATCGGCAAGATCCGCCTGTGGATCACGATTGCGAATGTCAACGCCCAGTACAAGTTCCT
GGAGAGGAGCTTTTTGTTCGAGGGCGGGTTGGATGGTCGGAGTTGGTTTAAGCATGTTGTTTTTGCGCCTGGGCT
TTGGACTGGCTATGCTGGAGGTTCGTTTCCCCTTCCCCCCCCTTTTTTTCGTATCTGTGGGGAAAGAGAGGTGAT
GCTGATGGGTGGGATAGCTGTTTTTCCAGGCTTGATGGAGAGTATCGATGCGAGGGATTATAATAATGGGTTGAA
GTGGGCTGCTATCATCGACCGGTGTGTCTGGCGCGCGATCCGCGGTGTTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail