Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5886
Gene name
LocationContig_604:9021..10583
Strand-
Gene length (bp)1562
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07915 PRKCSH Glucosidase II beta subunit-like protein 8.2E-17 143 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA7|OS9_GIBZE Protein OS-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YOS1 PE=3 SV=1 5 476 0.0E+00
sp|Q872S3|OS9_NEUCR Protein OS-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yos-9 PE=3 SV=1 18 373 7.0E-100
sp|Q5BDB9|OS9_EMENI Protein OS-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yos9 PE=3 SV=1 1 496 1.0E-88
sp|Q4WCG2|OS9_ASPFU Protein OS-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yos9 PE=3 SV=1 1 493 4.0E-88
sp|Q6C3U1|OS9_YARLI Protein OS-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOS9 PE=3 SV=1 9 295 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA7|OS9_GIBZE Protein OS-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YOS1 PE=3 SV=1 5 476 0.0E+00
sp|Q872S3|OS9_NEUCR Protein OS-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yos-9 PE=3 SV=1 18 373 7.0E-100
sp|Q5BDB9|OS9_EMENI Protein OS-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yos9 PE=3 SV=1 1 496 1.0E-88
sp|Q4WCG2|OS9_ASPFU Protein OS-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yos9 PE=3 SV=1 1 493 4.0E-88
sp|Q6C3U1|OS9_YARLI Protein OS-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOS9 PE=3 SV=1 9 295 1.0E-30
sp|Q67WM9|OS9_ORYSJ Protein OS-9 homolog OS=Oryza sativa subsp. japonica GN=OS9 PE=2 SV=1 58 312 6.0E-17
sp|Q99220|OS9_YEAST Protein OS-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS9 PE=1 SV=1 114 301 2.0E-15
sp|Q8GWH3|OS9_ARATH Protein OS-9 homolog OS=Arabidopsis thaliana GN=OS9 PE=1 SV=1 58 311 2.0E-14
sp|Q9UTC8|OS9_SCHPO Protein OS-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos9 PE=3 SV=3 1 352 1.0E-12
sp|Q3MHX6|OS9_BOVIN Protein OS-9 OS=Bos taurus GN=OS9 PE=2 SV=1 135 306 5.0E-12
sp|Q13438|OS9_HUMAN Protein OS-9 OS=Homo sapiens GN=OS9 PE=1 SV=1 135 306 5.0E-12
sp|Q6BJ08|OS9_DEBHA Protein OS-9 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YOS9 PE=3 SV=2 150 322 4.0E-11
sp|Q8VEH8|ERLEC_MOUSE Endoplasmic reticulum lectin 1 OS=Mus musculus GN=Erlec1 PE=1 SV=1 66 324 8.0E-11
sp|Q8K2C7|OS9_MOUSE Protein OS-9 OS=Mus musculus GN=Os9 PE=1 SV=2 135 306 2.0E-10
sp|Q96DZ1|ERLEC_HUMAN Endoplasmic reticulum lectin 1 OS=Homo sapiens GN=ERLEC1 PE=1 SV=1 66 324 7.0E-09
sp|Q5R8S4|ERLEC_PONAB Endoplasmic reticulum lectin 1 OS=Pongo abelii GN=ERLEC1 PE=2 SV=1 66 324 8.0E-09
sp|Q756T2|OS9_ASHGO Protein OS-9 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YOS9 PE=3 SV=1 99 305 9.0E-09
sp|Q28IT1|ERLEC_XENTR Endoplasmic reticulum lectin 1 OS=Xenopus tropicalis GN=erlec1 PE=2 SV=1 143 292 1.0E-07
sp|Q08B78|ERLEC_XENLA Endoplasmic reticulum lectin 1 OS=Xenopus laevis GN=erlec1 PE=2 SV=1 67 324 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5886
MRAMMRPLNLVLLAFFGLGAARTPSFSIHDDLLAFPQFDVVFADGYISEKDADALLVDDRHPTYSADFSQPTMAA
HGAPDAPAAFSYELMSMAPHRYLCSIPVVEAPLPENQTANELAKAEEARELDRAAAKGWELLAQLEDSCLYFMSG
WWSYSFCNNREIVQFHALAAAPNGLPPRRDPHTAEFILGKVPAISASADRHSRRDQGEASSSPPPSSSSPAELQV
KGDQRYLVQRLEGGTVCDLTGRERTVEVQYHCAPNLSKDRIGWIKEVTICAYVMVINTPRLCHDVAFLPPEETRA
NRIRCQVIADESSPPPLLDQTTSQTSMADAQSAATAAAKMSDADGDKAEAEADGASSAEVTVGGVVIGARKVLSA
ADEAGKPPIKLAPPRGFWSGGAPTTTDDSSEVEVLVTAASKNDGGRIKMPTAEELERMEIDPLVVEEMKEKMMQM
AGDAGWQLEIVELNGGDLRELRGTIDESDADGDKDKDKGQEGSEETFFKEEL*
Coding >Ophun1|5886
ATGCGCGCCATGATGCGGCCTCTCAACTTGGTCTTGCTGGCCTTCTTTGGGCTCGGCGCCGCTCGTACGCCCAGC
TTCAGTATTCATGACGACCTCCTCGCCTTCCCTCAGTTCGACGTCGTCTTCGCAGATGGCTACATCTCCGAAAAG
GATGCCGATGCCCTACTCGTCGATGATCGTCATCCCACTTACTCGGCCGACTTCTCCCAGCCGACCATGGCCGCT
CATGGAGCGCCCGACGCGCCAGCCGCCTTCTCATACGAACTCATGAGCATGGCGCCTCATCGCTACCTCTGTTCT
ATCCCCGTCGTCGAGGCGCCGCTACCGGAGAATCAAACGGCTAATGAGTTGGCCAAGGCAGAGGAGGCTCGCGAG
TTGGATCGGGCCGCCGCAAAGGGCTGGGAACTACTGGCCCAGCTCGAGGACTCGTGCCTCTACTTCATGTCTGGC
TGGTGGAGTTACAGCTTCTGCAACAACCGCGAGATTGTCCAGTTTCACGCCCTCGCTGCCGCGCCTAATGGTCTG
CCTCCGAGGCGTGACCCGCATACGGCTGAGTTCATCCTCGGCAAGGTCCCTGCCATCTCGGCCTCGGCCGACCGG
CATTCGCGACGCGATCAGGGCGAGGCGTCGTCCTCGCCGCCGCCATCGTCATCGTCGCCTGCCGAGCTACAGGTG
AAGGGCGACCAGCGGTACCTGGTGCAGAGGCTCGAAGGCGGTACCGTCTGCGACCTCACGGGCCGCGAACGTACC
GTCGAGGTGCAGTACCACTGCGCGCCTAACCTGTCCAAGGATCGCATCGGCTGGATCAAGGAGGTCACCATCTGC
GCCTACGTCATGGTCATCAACACGCCCCGGTTGTGCCACGACGTCGCCTTTCTGCCACCAGAAGAGACGCGGGCC
AACCGGATTCGCTGTCAGGTCATTGCCGACGAATCATCGCCGCCGCCGCTGCTGGACCAGACAACGAGCCAGACT
TCCATGGCCGATGCACAGTCTGCGGCGACGGCAGCGGCCAAGATGTCTGACGCGGACGGCGACAAGGCCGAGGCC
GAGGCCGACGGAGCGTCGTCGGCCGAAGTGACGGTCGGTGGCGTCGTCATCGGCGCCCGCAAAGTCCTCTCCGCG
GCCGACGAGGCGGGAAAGCCGCCGATCAAGTTGGCGCCCCCGCGCGGCTTCTGGTCCGGCGGCGCGCCGACGACG
ACAGACGACAGCAGCGAGGTTGAAGTCCTGGTGACGGCAGCCAGCAAGAATGACGGCGGAAGGATCAAGATGCCG
ACGGCCGAAGAGCTGGAGCGCATGGAAATTGACCCGTTGGTGGTGGAGGAGATGAAGGAGAAGATGATGCAGATG
GCGGGCGACGCCGGCTGGCAGCTCGAGATTGTCGAGCTCAACGGCGGCGACCTTCGCGAGCTCCGGGGCACCATC
GATGAGAGCGATGCTGACGGCGACAAGGATAAGGATAAGGGGCAAGAGGGAAGCGAGGAGACGTTTTTCAAGGAG
GAACTGTAG
Transcript >Ophun1|5886
ATGCGCGCCATGATGCGGCCTCTCAACTTGGTCTTGCTGGCCTTCTTTGGGCTCGGCGCCGCTCGTACGCCCAGC
TTCAGTATTCATGACGACCTCCTCGCCTTCCCTCAGTTCGACGTCGTCTTCGCAGATGGCTACATCTCCGAAAAG
GATGCCGATGCCCTACTCGTCGATGATCGTCATCCCACTTACTCGGCCGACTTCTCCCAGCCGACCATGGCCGCT
CATGGAGCGCCCGACGCGCCAGCCGCCTTCTCATACGAACTCATGAGCATGGCGCCTCATCGCTACCTCTGTTCT
ATCCCCGTCGTCGAGGCGCCGCTACCGGAGAATCAAACGGCTAATGAGTTGGCCAAGGCAGAGGAGGCTCGCGAG
TTGGATCGGGCCGCCGCAAAGGGCTGGGAACTACTGGCCCAGCTCGAGGACTCGTGCCTCTACTTCATGTCTGGC
TGGTGGAGTTACAGCTTCTGCAACAACCGCGAGATTGTCCAGTTTCACGCCCTCGCTGCCGCGCCTAATGGTCTG
CCTCCGAGGCGTGACCCGCATACGGCTGAGTTCATCCTCGGCAAGGTCCCTGCCATCTCGGCCTCGGCCGACCGG
CATTCGCGACGCGATCAGGGCGAGGCGTCGTCCTCGCCGCCGCCATCGTCATCGTCGCCTGCCGAGCTACAGGTG
AAGGGCGACCAGCGGTACCTGGTGCAGAGGCTCGAAGGCGGTACCGTCTGCGACCTCACGGGCCGCGAACGTACC
GTCGAGGTGCAGTACCACTGCGCGCCTAACCTGTCCAAGGATCGCATCGGCTGGATCAAGGAGGTCACCATCTGC
GCCTACGTCATGGTCATCAACACGCCCCGGTTGTGCCACGACGTCGCCTTTCTGCCACCAGAAGAGACGCGGGCC
AACCGGATTCGCTGTCAGGTCATTGCCGACGAATCATCGCCGCCGCCGCTGCTGGACCAGACAACGAGCCAGACT
TCCATGGCCGATGCACAGTCTGCGGCGACGGCAGCGGCCAAGATGTCTGACGCGGACGGCGACAAGGCCGAGGCC
GAGGCCGACGGAGCGTCGTCGGCCGAAGTGACGGTCGGTGGCGTCGTCATCGGCGCCCGCAAAGTCCTCTCCGCG
GCCGACGAGGCGGGAAAGCCGCCGATCAAGTTGGCGCCCCCGCGCGGCTTCTGGTCCGGCGGCGCGCCGACGACG
ACAGACGACAGCAGCGAGGTTGAAGTCCTGGTGACGGCAGCCAGCAAGAATGACGGCGGAAGGATCAAGATGCCG
ACGGCCGAAGAGCTGGAGCGCATGGAAATTGACCCGTTGGTGGTGGAGGAGATGAAGGAGAAGATGATGCAGATG
GCGGGCGACGCCGGCTGGCAGCTCGAGATTGTCGAGCTCAACGGCGGCGACCTTCGCGAGCTCCGGGGCACCATC
GATGAGAGCGATGCTGACGGCGACAAGGATAAGGATAAGGGGCAAGAGGGAAGCGAGGAGACGTTTTTCAAGGAG
GAACTGTAG
Gene >Ophun1|5886
ATGCGCGCCATGATGCGGCCTCTCAACTTGGTCTTGCTGGCCTTCTTTGGGCTCGGCGCCGCTCGTACGCCCAGC
TTCAGTATTCATGACGACCTCCTCGCCTTCCCTCAGGTACGCCCTCTTCCACCTCTTGTCGCACGTCCGCTAATG
CAAGTCTCGTTCAGTTCGACGTCGTCTTCGCAGATGGCTACATCTCCGAAAAGGATGCCGATGCCCTACTCGTCG
ATGATCGTCATCCCACTTACTCGGCCGACTTCTCCCAGCCGACCATGGCCGCTCATGGAGCGCCCGACGCGCCAG
CCGCCTTCTCATACGAACTCATGAGCATGGCGCCTCATCGCTACCTCTGTTCTATCCCCGTCGTCGAGGCGCCGC
TACCGGAGAATCAAACGGCTAATGAGTTGGCCAAGGCAGAGGAGGCTCGCGAGTTGGATCGGGCCGCCGCAAAGG
GCTGGGAACTACTGGCCCAGCTCGAGGACTCGTGCCTCTACTTCATGTCTGGCTGGTGGAGTTACAGCTTCTGCA
ACAACCGCGAGATTGTCCAGTTTCACGCCCTCGCTGCCGCGCCTAATGGTCTGCCTCCGAGGCGTGACCCGCATA
CGGCTGAGTTCATCCTCGGCAAGGTCCCTGCCATCTCGGCCTCGGCCGACCGGCATTCGCGACGCGATCAGGGCG
AGGCGTCGTCCTCGCCGCCGCCATCGTCATCGTCGCCTGCCGAGCTACAGGTGAAGGGCGACCAGCGGTACCTGG
TGCAGAGGCTCGAAGGCGGTACCGTCTGCGACCTCACGGGCCGCGAACGTACCGTCGAGGTGCAGTACCACTGCG
CGCCTAACCTGTCCAAGGATCGCATCGGCTGGATCAAGGAGGTCACCATCTGCGCCTACGTCATGGTCATCAACA
CGCCCCGGTTGTGCCACGACGTCGCCTTTCTGCCACCAGAAGAGACGCGGGCCAACCGGATTCGCTGTCAGGTCA
TTGCCGACGAATCATCGCCGCCGCCGCTGCTGGACCAGACAACGAGCCAGACTTCCATGGCCGATGCACAGTCTG
CGGCGACGGCAGCGGCCAAGATGTCTGACGCGGACGGCGACAAGGCCGAGGCCGAGGCCGACGGAGCGTCGTCGG
CCGAAGTGACGGTCGGTGGCGTCGTCATCGGCGCCCGCAAAGTCCTCTCCGCGGCCGACGAGGCGGGAAAGCCGC
CGATCAAGTTGGCGCCCCCGCGCGGCTTCTGGTCCGGCGGCGCGCCGACGACGACAGACGACAGCAGCGAGGTTG
AAGTCCTGGTGACGGCAGCCAGCAAGAATGACGGCGGAAGGATCAAGATGCCGACGGCCGAAGAGCTGGAGCGCA
TGGAAATTGACCCGTTGGTGGTGGAGGAGATGAAGGAGAAGATGATGCAGATGGCGGGCGACGCCGGCTGGCAGC
TCGAGATTGTCGAGCTCAACGGCGGCGACCTTCGCGAGCTCCGGGGCACCATCGATGAGAGCGATGCTGACGGCG
ACAAGGATAAGGATAAGGGGCAAGAGGGAAGCGAGGAGACGTTTTTCAAGGAGGAACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail