Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5884
Gene name
LocationContig_604:4992..7583
Strand-
Gene length (bp)2591
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07989 Cnn_1N Centrosomin N-terminal motif 1 8.6E-08 136 202

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005815 microtubule organizing center Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5884
MDVPKAQQRRPLPSRPGSARIAESATSSSQLSSSQSAHRLHHATSPRPASRAMALPPQVDAPDALRQPALSSFLQ
EKLQRERRAECEKLTTSPSLSRTEASGSVDGGRFFHNSTDAARPRSSTGLELPKKKKGMGVKEMEQAVSNLHKQN
FDLKLELFHRRERQSALEERIEALEADREKSLTVADRLVDELDKREKAVEEAVAMIVTLEAEVDRLVRQRIQGSD
GPCNFCAHRRTSSSDRPARYDDDDDTAVATKSITRMPSFLSDRGDKTENLRNVYLGSRAGSSLSLPRVAEASSEA
EGATAHALASPTLSVLSESSFVSVYGNKAQGSELASSPPGYVDEPLVLDGFDAGTDRFVSPDVSINTHQPRQRAA
SVGRVTSLAKPPPRSSTAVPFQSLSSVMDYQSPLERLMRLDPSACRDDWPKRSSPRAGQATKEEKREALRRVMTD
APGGVRLNDHGMPPTPDTISTSTLHRFKNSDETLATHDQTPLGGALLPAADIRYATESSTGALLGHNTPPTAGAG
GKSRRPAGHRRQVSSGQQRPQSARGPRGADRQPGQNSHNGWESDSELSDRRSLESSLDIWLRESAKPDKMGGHIS
PDLFSFPQDAWACETAGGASGHALDLRSLRHQLFPWNGGPAPPDRSSSLRAEMGSNADGSSVSAARPRHRQSEDQ
QKSSDSQMPVSPQSPPPSQQQQQQQQNGEQKRYPPIAGHHGARAGLGRLFRRSLGGGPSPAAAPSQPAEEEYLPM
GVPSSVHRNNAPLNGTGADRSGATPPPIVLNPRQTPRRAESPSEVVAEADPVAPPAVSQQQQQQQQEGAGSSSTG
GRRKWLPQFGRPGSSRNKGG*
Coding >Ophun1|5884
ATGGACGTCCCCAAGGCCCAGCAGCGACGGCCACTTCCTTCTCGTCCAGGCAGCGCCCGCATCGCCGAATCCGCG
ACATCGTCGAGCCAGCTATCGAGCTCTCAGTCGGCGCACAGACTGCATCACGCCACCTCGCCCCGACCAGCTTCG
CGGGCCATGGCCCTTCCGCCGCAAGTCGACGCGCCCGACGCCCTCCGCCAGCCCGCCCTATCGTCCTTTTTGCAG
GAGAAGCTGCAGCGCGAACGGAGGGCCGAGTGCGAGAAACTGACGACGTCACCTTCGTTGTCCCGCACCGAGGCA
AGCGGTTCTGTCGACGGGGGGCGCTTCTTCCATAACAGCACCGACGCTGCTCGCCCGAGGTCCAGCACCGGCCTG
GAGCTGCCTAAGAAGAAGAAGGGCATGGGTGTCAAAGAGATGGAGCAGGCCGTGTCCAACCTCCACAAGCAAAAC
TTTGACCTCAAACTCGAGCTCTTCCACCGACGTGAGCGTCAATCCGCCTTGGAGGAGCGGATCGAGGCCCTCGAG
GCCGATAGGGAAAAGTCACTCACCGTCGCGGACAGGCTGGTCGACGAGTTGGATAAGCGCGAAAAGGCCGTAGAG
GAGGCCGTCGCCATGATCGTCACGCTTGAGGCCGAGGTCGACCGCCTCGTTCGTCAGCGTATTCAAGGCTCGGAC
GGCCCTTGTAACTTCTGCGCCCACCGCCGAACGTCAAGTTCAGACCGGCCGGCGAGATATGACGACGACGACGAC
ACCGCTGTTGCCACCAAGTCCATCACCCGCATGCCCAGCTTCCTGTCTGACCGCGGCGACAAGACGGAGAACCTG
CGCAACGTCTACCTCGGCAGCCGAGCCGGTAGCTCCCTCAGCCTCCCCCGCGTCGCAGAGGCTTCGTCCGAGGCC
GAGGGCGCGACCGCCCACGCATTGGCCAGCCCTACCCTCAGCGTCTTGAGCGAGAGTTCCTTCGTCAGCGTCTAC
GGAAACAAGGCTCAGGGCAGCGAGCTGGCTTCGTCGCCTCCCGGCTACGTCGACGAGCCTCTGGTACTCGACGGC
TTCGACGCCGGTACGGATAGGTTCGTCTCCCCAGATGTGTCCATCAACACCCACCAGCCGAGGCAGCGAGCCGCT
TCCGTTGGTCGCGTCACGAGCTTGGCCAAGCCCCCGCCGCGGTCGAGCACCGCCGTCCCCTTCCAGTCGCTGTCC
TCCGTCATGGACTACCAGAGCCCGCTCGAGCGGCTCATGCGCCTCGACCCGTCCGCCTGCAGAGACGACTGGCCT
AAGAGGTCGTCGCCCCGGGCCGGACAGGCCACCAAGGAGGAGAAGCGCGAGGCCCTGCGGCGCGTCATGACCGAT
GCCCCCGGCGGCGTCCGCCTGAACGACCACGGCATGCCCCCGACGCCCGATACGATCTCGACGTCGACGCTGCAC
CGGTTCAAGAACTCGGACGAGACGCTGGCCACCCACGACCAAACCCCTCTGGGCGGCGCCCTGCTGCCCGCTGCC
GACATTAGGTATGCCACCGAGTCTTCCACCGGCGCACTCCTCGGCCATAACACTCCACCGACGGCCGGTGCGGGT
GGCAAGTCCCGTCGGCCCGCAGGTCATCGGCGGCAGGTGTCGAGCGGCCAGCAGCGGCCGCAGTCGGCGAGAGGG
CCGAGAGGCGCGGATCGCCAGCCGGGCCAGAACAGCCACAACGGCTGGGAGAGCGACAGCGAGCTCTCGGACCGA
CGATCGCTGGAATCGAGTCTCGATATATGGCTGCGAGAGAGCGCCAAGCCGGATAAGATGGGCGGCCACATCTCG
CCGGACCTTTTCAGCTTCCCCCAGGACGCGTGGGCGTGTGAGACGGCCGGCGGCGCTTCGGGCCACGCGCTTGAC
CTCCGCTCCCTCCGTCATCAGCTGTTCCCCTGGAACGGCGGGCCAGCGCCGCCCGATCGGAGTTCCAGCCTCCGG
GCGGAGATGGGATCCAATGCCGACGGATCGTCCGTGTCAGCTGCGCGGCCCCGACACCGACAGAGTGAAGATCAG
CAGAAAAGCTCGGATTCGCAGATGCCAGTGTCGCCGCAGTCGCCGCCGCCTTCACAACAGCAGCAGCAGCAGCAG
CAAAACGGAGAACAGAAGCGCTACCCTCCCATCGCAGGCCATCACGGGGCCCGTGCCGGCCTCGGCAGGCTGTTT
CGGCGATCGCTCGGCGGCGGACCCTCGCCCGCTGCAGCACCTTCGCAGCCGGCCGAGGAGGAATATCTCCCGATG
GGTGTGCCGTCGTCGGTGCATCGCAACAATGCGCCCCTGAACGGAACCGGGGCCGATCGCTCGGGCGCGACGCCA
CCACCCATCGTGCTGAACCCACGGCAGACGCCGCGGCGGGCCGAATCACCGTCGGAGGTGGTGGCCGAGGCCGAT
CCCGTCGCGCCGCCGGCCGTTTCTCAGCAGCAGCAGCAGCAGCAGCAGGAAGGGGCCGGTTCGTCGAGCACGGGA
GGGAGGAGGAAGTGGCTTCCGCAGTTTGGGAGGCCGGGCAGTTCCAGGAATAAGGGCGGGTAG
Transcript >Ophun1|5884
ATGGACGTCCCCAAGGCCCAGCAGCGACGGCCACTTCCTTCTCGTCCAGGCAGCGCCCGCATCGCCGAATCCGCG
ACATCGTCGAGCCAGCTATCGAGCTCTCAGTCGGCGCACAGACTGCATCACGCCACCTCGCCCCGACCAGCTTCG
CGGGCCATGGCCCTTCCGCCGCAAGTCGACGCGCCCGACGCCCTCCGCCAGCCCGCCCTATCGTCCTTTTTGCAG
GAGAAGCTGCAGCGCGAACGGAGGGCCGAGTGCGAGAAACTGACGACGTCACCTTCGTTGTCCCGCACCGAGGCA
AGCGGTTCTGTCGACGGGGGGCGCTTCTTCCATAACAGCACCGACGCTGCTCGCCCGAGGTCCAGCACCGGCCTG
GAGCTGCCTAAGAAGAAGAAGGGCATGGGTGTCAAAGAGATGGAGCAGGCCGTGTCCAACCTCCACAAGCAAAAC
TTTGACCTCAAACTCGAGCTCTTCCACCGACGTGAGCGTCAATCCGCCTTGGAGGAGCGGATCGAGGCCCTCGAG
GCCGATAGGGAAAAGTCACTCACCGTCGCGGACAGGCTGGTCGACGAGTTGGATAAGCGCGAAAAGGCCGTAGAG
GAGGCCGTCGCCATGATCGTCACGCTTGAGGCCGAGGTCGACCGCCTCGTTCGTCAGCGTATTCAAGGCTCGGAC
GGCCCTTGTAACTTCTGCGCCCACCGCCGAACGTCAAGTTCAGACCGGCCGGCGAGATATGACGACGACGACGAC
ACCGCTGTTGCCACCAAGTCCATCACCCGCATGCCCAGCTTCCTGTCTGACCGCGGCGACAAGACGGAGAACCTG
CGCAACGTCTACCTCGGCAGCCGAGCCGGTAGCTCCCTCAGCCTCCCCCGCGTCGCAGAGGCTTCGTCCGAGGCC
GAGGGCGCGACCGCCCACGCATTGGCCAGCCCTACCCTCAGCGTCTTGAGCGAGAGTTCCTTCGTCAGCGTCTAC
GGAAACAAGGCTCAGGGCAGCGAGCTGGCTTCGTCGCCTCCCGGCTACGTCGACGAGCCTCTGGTACTCGACGGC
TTCGACGCCGGTACGGATAGGTTCGTCTCCCCAGATGTGTCCATCAACACCCACCAGCCGAGGCAGCGAGCCGCT
TCCGTTGGTCGCGTCACGAGCTTGGCCAAGCCCCCGCCGCGGTCGAGCACCGCCGTCCCCTTCCAGTCGCTGTCC
TCCGTCATGGACTACCAGAGCCCGCTCGAGCGGCTCATGCGCCTCGACCCGTCCGCCTGCAGAGACGACTGGCCT
AAGAGGTCGTCGCCCCGGGCCGGACAGGCCACCAAGGAGGAGAAGCGCGAGGCCCTGCGGCGCGTCATGACCGAT
GCCCCCGGCGGCGTCCGCCTGAACGACCACGGCATGCCCCCGACGCCCGATACGATCTCGACGTCGACGCTGCAC
CGGTTCAAGAACTCGGACGAGACGCTGGCCACCCACGACCAAACCCCTCTGGGCGGCGCCCTGCTGCCCGCTGCC
GACATTAGGTATGCCACCGAGTCTTCCACCGGCGCACTCCTCGGCCATAACACTCCACCGACGGCCGGTGCGGGT
GGCAAGTCCCGTCGGCCCGCAGGTCATCGGCGGCAGGTGTCGAGCGGCCAGCAGCGGCCGCAGTCGGCGAGAGGG
CCGAGAGGCGCGGATCGCCAGCCGGGCCAGAACAGCCACAACGGCTGGGAGAGCGACAGCGAGCTCTCGGACCGA
CGATCGCTGGAATCGAGTCTCGATATATGGCTGCGAGAGAGCGCCAAGCCGGATAAGATGGGCGGCCACATCTCG
CCGGACCTTTTCAGCTTCCCCCAGGACGCGTGGGCGTGTGAGACGGCCGGCGGCGCTTCGGGCCACGCGCTTGAC
CTCCGCTCCCTCCGTCATCAGCTGTTCCCCTGGAACGGCGGGCCAGCGCCGCCCGATCGGAGTTCCAGCCTCCGG
GCGGAGATGGGATCCAATGCCGACGGATCGTCCGTGTCAGCTGCGCGGCCCCGACACCGACAGAGTGAAGATCAG
CAGAAAAGCTCGGATTCGCAGATGCCAGTGTCGCCGCAGTCGCCGCCGCCTTCACAACAGCAGCAGCAGCAGCAG
CAAAACGGAGAACAGAAGCGCTACCCTCCCATCGCAGGCCATCACGGGGCCCGTGCCGGCCTCGGCAGGCTGTTT
CGGCGATCGCTCGGCGGCGGACCCTCGCCCGCTGCAGCACCTTCGCAGCCGGCCGAGGAGGAATATCTCCCGATG
GGTGTGCCGTCGTCGGTGCATCGCAACAATGCGCCCCTGAACGGAACCGGGGCCGATCGCTCGGGCGCGACGCCA
CCACCCATCGTGCTGAACCCACGGCAGACGCCGCGGCGGGCCGAATCACCGTCGGAGGTGGTGGCCGAGGCCGAT
CCCGTCGCGCCGCCGGCCGTTTCTCAGCAGCAGCAGCAGCAGCAGCAGGAAGGGGCCGGTTCGTCGAGCACGGGA
GGGAGGAGGAAGTGGCTTCCGCAGTTTGGGAGGCCGGGCAGTTCCAGGAATAAGGGCGGGTAG
Gene >Ophun1|5884
ATGGACGTCCCCAAGGCCCAGCAGCGACGGCCACTTCCTTCTCGTCCAGGCAGCGCCCGCATCGCCGAATCCGCG
ACATCGTCGAGCCAGCTATCGAGCTCTCAGTCGGCGCACAGACTGCATCACGCCACCTCGCCCCGACCAGCTTCG
CGGGCCATGGCCCTTCCGCCGCAAGTCGACGCGCCCGACGCCCTCCGCCAGCCCGCCCTATCGTCCTTTTTGCAG
GAGAAGCTGCAGCGCGAACGGAGGGCCGAGTGCGAGAAACTGACGACGTCACCTTCGTTGTCCCGCACCGAGGCA
AGCGGTTCTGTCGACGGGGGGCGCTTCTTCCATAACAGCACCGACGCTGCTCGCCCGAGGTCCAGCACCGGCCTG
GAGCTGCCTAAGAAGAAGAAGGGCATGGGTGTCAAAGAGATGGAGCAGGTAGGCGTTCCCTTTTCTACGTGTAGT
GTCGATGGTCGCTGATGATTGTGCAGGCCGTGTCCAACCTCCACAAGCAAAACTTTGACCTCAAACTCGAGCTCT
TCCACCGACGTGAGCGTCAATCCGCCTTGGAGGAGCGGATCGAGGCCCTCGAGGCCGATAGGGAAAAGTCACTCA
CCGTCGCGGACAGGCTGGTCGACGAGTTGGATAAGCGCGAAAAGGCCGTAGAGGAGGCCGTCGCCATGATCGTCA
CGCTTGAGGCCGAGGTCGACCGCCTCGTTCGTCAGCGTATTCAAGGCTCGGACGGCCCTTGTAACTTCTGCGCCC
ACCGCCGAACGTCAAGTTCAGACCGGCCGGCGAGATATGACGACGACGACGACACCGCTGTTGCCACCAAGTCCA
TCACCCGCATGCCCAGCTTCCTGTCTGACCGCGGCGACAAGACGGAGAACCTGCGCAACGTCTACCTCGGCAGCC
GAGCCGGTAGCTCCCTCAGCCTCCCCCGCGTCGCAGAGGCTTCGTCCGAGGCCGAGGGCGCGACCGCCCACGCAT
TGGCCAGCCCTACCCTCAGCGTCTTGAGCGAGAGTTCCTTCGTCAGCGTCTACGGAAACAAGGCTCAGGGCAGCG
AGCTGGCTTCGTCGCCTCCCGGCTACGTCGACGAGCCTCTGGTACTCGACGGCTTCGACGCCGGTACGGATAGGT
TCGTCTCCCCAGATGTGTCCATCAACACCCACCAGCCGAGGCAGCGAGCCGCTTCCGTTGGTCGCGTCACGAGCT
TGGCCAAGCCCCCGCCGCGGTCGAGCACCGCCGTCCCCTTCCAGTCGCTGTCCTCCGTCATGGACTACCAGAGCC
CGCTCGAGCGGCTCATGCGCCTCGACCCGTCCGCCTGCAGAGACGACTGGCCTAAGAGGTCGTCGCCCCGGGCCG
GACAGGCCACCAAGGAGGAGAAGCGCGAGGCCCTGCGGCGCGTCATGACCGATGCCCCCGGCGGCGTCCGCCTGA
ACGACCACGGCATGCCCCCGACGCCCGATACGATCTCGACGTCGACGCTGCACCGGTTCAAGAACTCGGACGAGA
CGCTGGCCACCCACGACCAAACCCCTCTGGGCGGCGCCCTGCTGCCCGCTGCCGACATTAGGTATGCCACCGAGT
CTTCCACCGGCGCACTCCTCGGCCATAACACTCCACCGACGGCCGGTGCGGGTGGCAAGTCCCGTCGGCCCGCAG
GTCATCGGCGGCAGGTGTCGAGCGGCCAGCAGCGGCCGCAGTCGGCGAGAGGGCCGAGAGGCGCGGATCGCCAGC
CGGGCCAGAACAGCCACAACGGCTGGGAGAGCGACAGCGAGCTCTCGGACCGACGATCGCTGGAATCGAGTCTCG
ATATATGGCTGCGAGAGAGCGCCAAGCCGGATAAGATGGGCGGCCACATCTCGCCGGACCTTTTCAGCTTCCCCC
AGGACGCGTGGGCGTGTGAGACGGCCGGCGGCGCTTCGGGCCACGCGCTTGACCTCCGCTCCCTCCGTCATCAGC
TGTTCCCCTGGAACGGCGGGCCAGCGCCGCCCGATCGGAGTTCCAGCCTCCGGGCGGAGATGGGATCCAATGCCG
ACGGATCGTCCGTGTCAGCTGCGCGGCCCCGACACCGACAGAGTGAAGATCAGCAGAAAAGCTCGGATTCGCAGA
TGCCAGTGTCGCCGCAGTCGCCGCCGCCTTCACAACAGCAGCAGCAGCAGCAGCAAAACGGAGAACAGAAGCGCT
ACCCTCCCATCGCAGGCCATCACGGGGCCCGTGCCGGCCTCGGCAGGCTGTTTCGGCGATCGCTCGGCGGCGGAC
CCTCGCCCGCTGCAGCACCTTCGCAGCCGGCCGAGGAGGAATATCTCCCGATGGGTGTGCCGTCGTCGGTGCATC
GCAACAATGCGCCCCTGAACGGAACCGGGGCCGATCGCTCGGGCGCGACGCCACCACCCATCGTGCTGAACCCAC
GGCAGACGCCGCGGCGGGCCGAATCACCGTCGGAGGTGGTGGCCGAGGCCGATCCCGTCGCGCCGCCGGCCGTTT
CTCAGCAGCAGCAGCAGCAGCAGCAGGAAGGGGCCGGTTCGTCGAGCACGGGAGGGAGGAGGAAGTGGCTTCCGC
AGTTTGGGAGGCCGGGCAGTTCCAGGAATAAGGGCGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail