Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5880
Gene name
LocationContig_603:7538..8649
Strand-
Gene length (bp)1111
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13874 Nup54 Nucleoporin complex subunit 54 6.8E-36 127 262
PF18570 Nup54_57_C NUP57/Nup54 C-terminal domain 2.3E-14 293 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0R2|NUP57_CHATD Nucleoporin NUP57 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP57 PE=1 SV=1 69 331 5.0E-113
sp|O42963|NUP44_SCHPO Nucleoporin nup44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup44 PE=2 SV=1 82 322 8.0E-32
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 3 277 6.0E-26
sp|Q8BTS4|NUP54_MOUSE Nuclear pore complex protein Nup54 OS=Mus musculus GN=Nup54 PE=1 SV=1 130 322 7.0E-08
sp|P70582|NUP54_RAT Nuclear pore complex protein Nup54 OS=Rattus norvegicus GN=Nup54 PE=1 SV=1 130 322 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0R2|NUP57_CHATD Nucleoporin NUP57 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP57 PE=1 SV=1 69 331 5.0E-113
sp|O42963|NUP44_SCHPO Nucleoporin nup44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup44 PE=2 SV=1 82 322 8.0E-32
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 3 277 6.0E-26
sp|Q8BTS4|NUP54_MOUSE Nuclear pore complex protein Nup54 OS=Mus musculus GN=Nup54 PE=1 SV=1 130 322 7.0E-08
sp|P70582|NUP54_RAT Nuclear pore complex protein Nup54 OS=Rattus norvegicus GN=Nup54 PE=1 SV=1 130 322 3.0E-07
sp|Q7Z3B4|NUP54_HUMAN Nucleoporin p54 OS=Homo sapiens GN=NUP54 PE=1 SV=2 130 322 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5880
MSLFGQSLSLGSGGLFASTQQQPQPTQQSTNVLGQSLTAGQQPTNTGFAGLQQSQQAQSMPVLAQSAAQLSSSLW
QPGKETPHQKPILDQIKLVTDKWDPASPNCVFKHYFYNKVDEAHIPFYKPQPYEDPREWEEALQNKPAPGFMPVV
CSGYTGVADRLRTQTRAISDFNTRLHQVNGGLDAILQRHELETEVRALAARRRQTAIGERCLALAARLQVVRNRG
YALSGDEDDLKNRLQSLEREVQDPALGAREEELWSRLIVLRGYSDRLDKELDQPAGAEGEALDSETYAKAKRVLE
DYDKQLGHLKKELESLGADLEEWDKSHEANPKSR*
Coding >Ophun1|5880
ATGTCGCTCTTCGGCCAGTCGCTGAGTCTCGGCTCTGGGGGCCTCTTTGCTTCGACGCAACAGCAGCCGCAGCCC
ACGCAACAGAGCACCAATGTCCTGGGCCAGAGCCTGACGGCCGGCCAGCAGCCGACCAATACTGGTTTCGCCGGG
CTGCAGCAATCGCAGCAGGCTCAGTCCATGCCCGTCCTCGCGCAGTCGGCCGCCCAGCTTTCCAGCTCACTGTGG
CAACCGGGCAAGGAGACTCCGCACCAGAAACCTATCCTCGACCAGATCAAGCTCGTGACGGACAAGTGGGATCCG
GCGAGTCCAAACTGCGTATTCAAGCATTACTTTTACAACAAGGTCGACGAGGCACACATCCCCTTCTACAAGCCG
CAGCCATACGAGGACCCGCGCGAGTGGGAAGAGGCGCTGCAGAATAAGCCCGCGCCGGGCTTCATGCCCGTAGTC
TGCTCGGGCTACACCGGCGTCGCTGATCGCTTACGCACCCAGACGCGGGCCATTTCCGACTTCAACACGCGCCTG
CACCAGGTCAACGGCGGCCTCGACGCCATCCTGCAGCGGCACGAGCTCGAAACGGAAGTACGCGCGCTGGCTGCG
CGGCGACGGCAGACGGCCATCGGCGAGCGGTGTCTCGCCCTAGCGGCCCGTCTGCAGGTCGTGCGTAACCGAGGA
TATGCGCTCAGCGGCGACGAAGACGATCTCAAGAACAGGCTCCAGAGCCTCGAGAGGGAGGTTCAAGACCCGGCG
CTGGGAGCTAGAGAGGAGGAGCTGTGGAGCAGGCTCATCGTTCTAAGGGGATACTCAGACCGACTGGACAAGGAG
CTGGATCAGCCTGCCGGCGCAGAGGGCGAGGCGCTCGACAGCGAGACATACGCCAAGGCAAAGAGGGTTTTGGAG
GACTACGACAAACAGCTGGGACATCTGAAAAAGGAGCTCGAATCCCTCGGTGCCGATCTGGAGGAGTGGGACAAG
AGCCACGAGGCGAACCCCAAGTCCAGATGA
Transcript >Ophun1|5880
ATGTCGCTCTTCGGCCAGTCGCTGAGTCTCGGCTCTGGGGGCCTCTTTGCTTCGACGCAACAGCAGCCGCAGCCC
ACGCAACAGAGCACCAATGTCCTGGGCCAGAGCCTGACGGCCGGCCAGCAGCCGACCAATACTGGTTTCGCCGGG
CTGCAGCAATCGCAGCAGGCTCAGTCCATGCCCGTCCTCGCGCAGTCGGCCGCCCAGCTTTCCAGCTCACTGTGG
CAACCGGGCAAGGAGACTCCGCACCAGAAACCTATCCTCGACCAGATCAAGCTCGTGACGGACAAGTGGGATCCG
GCGAGTCCAAACTGCGTATTCAAGCATTACTTTTACAACAAGGTCGACGAGGCACACATCCCCTTCTACAAGCCG
CAGCCATACGAGGACCCGCGCGAGTGGGAAGAGGCGCTGCAGAATAAGCCCGCGCCGGGCTTCATGCCCGTAGTC
TGCTCGGGCTACACCGGCGTCGCTGATCGCTTACGCACCCAGACGCGGGCCATTTCCGACTTCAACACGCGCCTG
CACCAGGTCAACGGCGGCCTCGACGCCATCCTGCAGCGGCACGAGCTCGAAACGGAAGTACGCGCGCTGGCTGCG
CGGCGACGGCAGACGGCCATCGGCGAGCGGTGTCTCGCCCTAGCGGCCCGTCTGCAGGTCGTGCGTAACCGAGGA
TATGCGCTCAGCGGCGACGAAGACGATCTCAAGAACAGGCTCCAGAGCCTCGAGAGGGAGGTTCAAGACCCGGCG
CTGGGAGCTAGAGAGGAGGAGCTGTGGAGCAGGCTCATCGTTCTAAGGGGATACTCAGACCGACTGGACAAGGAG
CTGGATCAGCCTGCCGGCGCAGAGGGCGAGGCGCTCGACAGCGAGACATACGCCAAGGCAAAGAGGGTTTTGGAG
GACTACGACAAACAGCTGGGACATCTGAAAAAGGAGCTCGAATCCCTCGGTGCCGATCTGGAGGAGTGGGACAAG
AGCCACGAGGCGAACCCCAAGTCCAGATGA
Gene >Ophun1|5880
ATGTCGCTCTTCGGCCAGTCGCTGAGTCTCGGCTCTGGGGGCCTCTTTGCTTCGACGCAACAGCAGCCGCAGCCC
ACGCAACAGAGCACCAATGTCCTGGGCCAGAGCCTGACGGCCGGCCAGCAGCCGACCAATACTGGTTTCGCCGGG
CTGCAGCAATCGCAGCAGGCTCAGTCCATGCCCGTCCTCGCGCAGTCGGCCGCCCAGCTTTCCAGCTCACTGTGG
CAACCGGGCAAGGAGACTCCGCGTACGTCGTGTCCGCTGCTGGCCACTCATTCGTGATGCTGACAGGGCTCCAGA
CCAGAAACCTATCCTCGACCAGATCAAGCTCGTGACGGACAAGTGGGATCCGGCGAGTCCAAACTGCGTATTCAA
GCATTACTTTTACAACAAGGTCGACGAGGCACACATCCCCTTCTACAAGCCGCAGCCATACGAGGACCCGCGCGA
GTGGGAAGAGGCGCTGCAGAATAAGCCCGCGCCGGGCTTCATGCCCGTAGTCTGCTCGGGCTACACCGGCGTCGC
TGATCGCTTACGCACCCAGACGCGGGCCATTTCCGACTTCAACACGCGCCTGCACCAGGTCAACGGCGGCCTCGA
CGCCATCCTGCAGCGGCACGAGCTCGAAACGGAAGTACGCGCGCTGGCTGCGCGGCGACGGCAGACGGCCATCGG
CGAGCGGTGTCTCGCCCTAGCGGCCCGTCTGCAGGTCGTGCGTAACCGAGGATATGCGCTCAGCGGCGACGAAGA
CGATCTCAAGAACAGGCTCCAGAGCCTCGAGAGGGAGGTTCAAGACCCGGCGCTGGGAGCTAGAGAGGAGGAGCT
GTGGAGCAGGCTCATCGTTCTAAGGGGATACTCAGACCGACTGGACAAGGAGCTGGATCAGCCTGCCGGCGCAGA
GGGCGAGGCGCTCGACAGCGAGACATACGCCAAGGCAAAGAGGGTGCGCATATCAAGTTACCAGGCTACGATGGG
CGGGGCTGACCATGTGACGCAGGTTTTGGAGGACTACGACAAACAGCTGGGACATCTGAAAAAGGAGCTCGAATC
CCTCGGTGCCGATCTGGAGGAGTGGGACAAGAGCCACGAGGCGAACCCCAAGTCCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail