Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|588
Gene name
LocationContig_1181:1860..2969
Strand-
Gene length (bp)1109
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04080 Per1 Per1-like family 3.7E-108 59 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N9|PER1_SCHPO Protein PER1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.07 PE=3 SV=1 14 330 3.0E-72
sp|Q68EV0|PGAP3_XENLA Post-GPI attachment to proteins factor 3 OS=Xenopus laevis GN=pgap3 PE=2 SV=1 17 318 2.0E-53
sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3 OS=Xenopus tropicalis GN=pgap3 PE=2 SV=1 17 318 2.0E-52
sp|P25625|PER1_YEAST Protein PER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PER1 PE=1 SV=1 12 317 4.0E-52
sp|Q7K0P4|PGAP3_DROME Post-GPI attachment to proteins factor 3 OS=Drosophila melanogaster GN=PGAP3 PE=1 SV=2 15 312 5.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N9|PER1_SCHPO Protein PER1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.07 PE=3 SV=1 14 330 3.0E-72
sp|Q68EV0|PGAP3_XENLA Post-GPI attachment to proteins factor 3 OS=Xenopus laevis GN=pgap3 PE=2 SV=1 17 318 2.0E-53
sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3 OS=Xenopus tropicalis GN=pgap3 PE=2 SV=1 17 318 2.0E-52
sp|P25625|PER1_YEAST Protein PER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PER1 PE=1 SV=1 12 317 4.0E-52
sp|Q7K0P4|PGAP3_DROME Post-GPI attachment to proteins factor 3 OS=Drosophila melanogaster GN=PGAP3 PE=1 SV=2 15 312 5.0E-47
sp|A7YWP2|PGAP3_BOVIN Post-GPI attachment to proteins factor 3 OS=Bos taurus GN=PGAP3 PE=2 SV=1 27 318 2.0E-46
sp|A8WFS8|PGAP3_DANRE Post-GPI attachment to proteins factor 3 OS=Danio rerio GN=pgap3 PE=2 SV=1 27 318 6.0E-46
sp|Q96FM1|PGAP3_HUMAN Post-GPI attachment to proteins factor 3 OS=Homo sapiens GN=PGAP3 PE=1 SV=2 27 318 1.0E-45
sp|A2V7M9|PGAP3_CRIGR Post-GPI attachment to proteins factor 3 OS=Cricetulus griseus GN=PGAP3 PE=2 SV=1 28 318 6.0E-44
sp|A2A559|PGAP3_MOUSE Post-GPI attachment to proteins factor 3 OS=Mus musculus GN=Pgap3 PE=2 SV=1 25 318 9.0E-43
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0090407 organophosphate biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006643 membrane lipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006497 protein lipidation No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0006629 lipid metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0008150 biological_process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0036211 protein modification process No
GO:0006664 glycolipid metabolic process No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 13 30 17
2 99 121 22
3 142 164 22
4 174 193 19
5 205 224 19
6 229 251 22
7 264 283 19
8 298 315 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|588
MAPPTLATPRPRFLILLVVLVLCRVASASVGDRSPEFQHCLDICKTENCAPGREQTPIPLIRRLLLWNCASECDY
TCQHIVTTQRLASARPVVQFHGKWPFYRFLGMQEPFSVLFSLGNLWAHWNGLHKVQTRIPISYGLRPWYVWLARI
GIVTWCFSAIFHMRDFPVTEQLDYFAAGASVLYGMYYTPIRIFRLDRPTAQRRSLLRLWSVLCVGLYLAHVAYLK
GVRWDYTYNMAANVSAGIVHNALWTWYSWDSYRKSRRPWAMLPGLVVAWIMFAMSMELFDFPPWLGSIDAHSLWH
LMTIGPTFIWYSFLVRDAQEDVAGAERLKA*
Coding >Ophun1|588
ATGGCGCCTCCGACTCTGGCGACGCCTCGCCCTCGATTCTTGATACTGCTTGTCGTGTTGGTTCTCTGTCGCGTG
GCCAGCGCTTCCGTCGGTGATCGGTCGCCCGAGTTCCAGCATTGCCTTGATATCTGCAAGACTGAAAACTGCGCG
CCTGGGCGAGAACAAACTCCGATCCCTCTCATCCGCCGTCTCCTCCTGTGGAACTGCGCCTCAGAATGCGACTAC
ACGTGCCAGCACATCGTCACGACCCAGCGACTGGCCTCGGCCCGCCCCGTCGTCCAGTTCCACGGGAAATGGCCC
TTTTACCGCTTCCTCGGCATGCAGGAGCCCTTTTCCGTCCTCTTCTCGCTGGGGAACCTCTGGGCGCACTGGAAC
GGGCTGCATAAGGTGCAGACGCGCATCCCCATCAGCTACGGCCTGCGACCCTGGTACGTCTGGCTCGCCCGCATC
GGCATCGTCACCTGGTGCTTTAGTGCCATCTTCCACATGCGTGACTTTCCCGTCACAGAACAGCTCGATTACTTT
GCCGCCGGCGCCAGCGTCTTATACGGCATGTACTACACGCCCATTCGCATATTCCGCCTTGACCGGCCGACGGCT
CAGCGCCGGTCCCTGCTACGGCTTTGGTCCGTGCTTTGCGTGGGCCTCTATCTCGCTCATGTTGCCTACCTCAAG
GGCGTTCGCTGGGACTACACGTATAACATGGCGGCCAACGTCTCGGCCGGCATCGTTCACAATGCGCTGTGGACG
TGGTACAGCTGGGACAGCTACCGCAAGTCGCGACGTCCCTGGGCCATGCTTCCCGGTCTCGTCGTGGCGTGGATC
ATGTTCGCCATGAGCATGGAGCTGTTCGACTTTCCCCCCTGGCTGGGCAGCATCGACGCCCACAGCCTGTGGCAT
CTCATGACCATCGGGCCCACCTTTATCTGGTACAGCTTCCTCGTCAGAGACGCTCAAGAAGATGTCGCCGGAGCG
GAGAGGCTCAAAGCCTGA
Transcript >Ophun1|588
ATGGCGCCTCCGACTCTGGCGACGCCTCGCCCTCGATTCTTGATACTGCTTGTCGTGTTGGTTCTCTGTCGCGTG
GCCAGCGCTTCCGTCGGTGATCGGTCGCCCGAGTTCCAGCATTGCCTTGATATCTGCAAGACTGAAAACTGCGCG
CCTGGGCGAGAACAAACTCCGATCCCTCTCATCCGCCGTCTCCTCCTGTGGAACTGCGCCTCAGAATGCGACTAC
ACGTGCCAGCACATCGTCACGACCCAGCGACTGGCCTCGGCCCGCCCCGTCGTCCAGTTCCACGGGAAATGGCCC
TTTTACCGCTTCCTCGGCATGCAGGAGCCCTTTTCCGTCCTCTTCTCGCTGGGGAACCTCTGGGCGCACTGGAAC
GGGCTGCATAAGGTGCAGACGCGCATCCCCATCAGCTACGGCCTGCGACCCTGGTACGTCTGGCTCGCCCGCATC
GGCATCGTCACCTGGTGCTTTAGTGCCATCTTCCACATGCGTGACTTTCCCGTCACAGAACAGCTCGATTACTTT
GCCGCCGGCGCCAGCGTCTTATACGGCATGTACTACACGCCCATTCGCATATTCCGCCTTGACCGGCCGACGGCT
CAGCGCCGGTCCCTGCTACGGCTTTGGTCCGTGCTTTGCGTGGGCCTCTATCTCGCTCATGTTGCCTACCTCAAG
GGCGTTCGCTGGGACTACACGTATAACATGGCGGCCAACGTCTCGGCCGGCATCGTTCACAATGCGCTGTGGACG
TGGTACAGCTGGGACAGCTACCGCAAGTCGCGACGTCCCTGGGCCATGCTTCCCGGTCTCGTCGTGGCGTGGATC
ATGTTCGCCATGAGCATGGAGCTGTTCGACTTTCCCCCCTGGCTGGGCAGCATCGACGCCCACAGCCTGTGGCAT
CTCATGACCATCGGGCCCACCTTTATCTGGTACAGCTTCCTCGTCAGAGACGCTCAAGAAGATGTCGCCGGAGCG
GAGAGGCTCAAAGCCTGA
Gene >Ophun1|588
ATGGCGCCTCCGACTCTGGCGACGCCTCGCCCTCGATTCTTGATACTGCTTGTCGTGTTGGTTCTCTGTCGCGTG
GCCAGCGCTTCCGTCGGTGATCGGTCGCCCGAGTTCCAGCATTGCCTTGATGTGAGTTGTTCTTTGCCGTCTTGC
GAGAGGGGCGAATGATTGCTGATGGGAATACAGATCTGCAAGACTGAAAACTGCGCGCCTGGGCGAGAACAAACT
CCGATCCGTACGTCCTTGTACGACTTCTCTTCGAATTCCCTCCGGCTAACAAACCCCGTCCTCCAGCTCTCATCC
GCCGTCTCCTCCTGTGGAACTGCGCCTCAGAATGCGACTACACGTGCCAGCACATCGTCACGACCCAGCGACTGG
CCTCGGCCCGCCCCGTCGTCCAGTTCCACGGGAAATGGCCCTTTTACCGCTTCCTCGGCATGCAGGAGCCCTTTT
CCGTCCTCTTCTCGCTGGGGAACCTCTGGGCGCACTGGAACGGGCTGCATAAGGTGCAGACGCGCATCCCCATCA
GCTACGGCCTGCGACCCTGGTACGTCTGGCTCGCCCGCATCGGCATCGTCACCTGGTGCTTTAGTGCCATCTTCC
ACATGCGTGACTTTCCCGTCACAGAACAGCTCGATTACTTTGCCGCCGGCGCCAGCGTCTTATACGGCATGTACT
ACACGCCCATTCGCATATTCCGCCTTGACCGGCCGACGGCTCAGCGCCGGTCCCTGCTACGGCTTTGGTCCGTGC
TTTGCGTGGGCCTCTATCTCGCTCATGTTGCCTACCTCAAGGGCGTTCGCTGGGACTACACGTATAACATGGCGG
CCAACGTCTCGGCCGGCATCGTTCACAATGCGCTGTGGACGTGGTACAGCTGGGACAGCTACCGCAAGTCGCGAC
GTCCCTGGGCCATGCTTCCCGGTCTCGTCGTGGCGTGGATCATGTTCGCCATGAGCATGGAGCTGTTCGACTTTC
CCCCCTGGCTGGGCAGCATCGACGCCCACAGCCTGTGGCATCTCATGACCATCGGGCCCACCTTTATCTGGTACA
GCTTCCTCGTCAGAGACGCTCAAGAAGATGTCGCCGGAGCGGAGAGGCTCAAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail