Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5879
Gene name
LocationContig_603:2453..6012
Strand-
Gene length (bp)3559
Transcript length (bp)3435
Coding sequence length (bp)3435
Protein length (aa) 1145

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02347 GDC-P Glycine cleavage system P-protein 1.7E-145 106 481
PF02347 GDC-P Glycine cleavage system P-protein 4.2E-11 576 864

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09785|GCSP_SCHPO Putative glycine dehydrogenase (decarboxylating), mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv2 PE=3 SV=2 103 1078 0.0E+00
sp|Q54KM7|GCSP_DICDI Glycine dehydrogenase (decarboxylating), mitochondrial OS=Dictyostelium discoideum GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|P49095|GCSP_YEAST Glycine dehydrogenase (decarboxylating), mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCV2 PE=1 SV=1 88 1084 0.0E+00
sp|Q6MPZ6|GCSP_BDEBA Glycine dehydrogenase (decarboxylating) OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q7WP29|GCSP_BORBR Glycine dehydrogenase (decarboxylating) OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09785|GCSP_SCHPO Putative glycine dehydrogenase (decarboxylating), mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv2 PE=3 SV=2 103 1078 0.0E+00
sp|Q54KM7|GCSP_DICDI Glycine dehydrogenase (decarboxylating), mitochondrial OS=Dictyostelium discoideum GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|P49095|GCSP_YEAST Glycine dehydrogenase (decarboxylating), mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCV2 PE=1 SV=1 88 1084 0.0E+00
sp|Q6MPZ6|GCSP_BDEBA Glycine dehydrogenase (decarboxylating) OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q7WP29|GCSP_BORBR Glycine dehydrogenase (decarboxylating) OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q7W1C4|GCSP_BORPA Glycine dehydrogenase (decarboxylating) OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|B2J427|GCSP_NOSP7 Glycine dehydrogenase (decarboxylating) OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gcvP PE=3 SV=1 95 1079 0.0E+00
sp|Q7W0E3|GCSP_BORPE Glycine dehydrogenase (decarboxylating) OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q91W43|GCSP_MOUSE Glycine dehydrogenase (decarboxylating), mitochondrial OS=Mus musculus GN=Gldc PE=1 SV=1 95 1095 0.0E+00
sp|A9I7K9|GCSP_BORPD Glycine dehydrogenase (decarboxylating) OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q3M9G1|GCSP_ANAVT Glycine dehydrogenase (decarboxylating) OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|P23378|GCSP_HUMAN Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens GN=GLDC PE=1 SV=2 95 1095 0.0E+00
sp|O49954|GCSP_SOLTU Glycine dehydrogenase (decarboxylating), mitochondrial OS=Solanum tuberosum GN=GDCSP PE=2 SV=1 103 1084 0.0E+00
sp|O80988|GCSP2_ARATH Glycine dehydrogenase (decarboxylating) 2, mitochondrial OS=Arabidopsis thaliana GN=GLDP2 PE=2 SV=1 103 1088 0.0E+00
sp|Q94B78|GCSP1_ARATH Glycine dehydrogenase (decarboxylating) 1, mitochondrial OS=Arabidopsis thaliana GN=GLDP1 PE=1 SV=2 103 1080 0.0E+00
sp|Q8YNF9|GCSP_NOSS1 Glycine dehydrogenase (decarboxylating) OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q8DII3|GCSP_THEEB Glycine dehydrogenase (decarboxylating) OS=Thermosynechococcus elongatus (strain BP-1) GN=gcvP PE=3 SV=1 103 1075 0.0E+00
sp|Q6LHN5|GCSP_PHOPR Glycine dehydrogenase (decarboxylating) OS=Photobacterium profundum GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q2KYL7|GCSP_BORA1 Glycine dehydrogenase (decarboxylating) OS=Bordetella avium (strain 197N) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q7U3Q5|GCSP_SYNPX Glycine dehydrogenase (decarboxylating) OS=Synechococcus sp. (strain WH8102) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|P26969|GCSP_PEA Glycine dehydrogenase (decarboxylating), mitochondrial OS=Pisum sativum GN=GDCSP PE=1 SV=1 103 1084 0.0E+00
sp|B2T7I8|GCSP_BURPP Glycine dehydrogenase (decarboxylating) OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B1KG87|GCSP_SHEWM Glycine dehydrogenase (decarboxylating) OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gcvP PE=3 SV=1 98 1080 0.0E+00
sp|Q4K7Q8|GCSP1_PSEF5 Glycine dehydrogenase (decarboxylating) 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gcvP1 PE=3 SV=1 103 1079 0.0E+00
sp|P15505|GCSP_CHICK Glycine dehydrogenase (decarboxylating), mitochondrial OS=Gallus gallus GN=GLDC PE=1 SV=2 95 1095 0.0E+00
sp|Q3IFW1|GCSP_PSEHT Glycine dehydrogenase (decarboxylating) OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gcvP PE=3 SV=1 90 1079 0.0E+00
sp|A1SY74|GCSP_PSYIN Glycine dehydrogenase (decarboxylating) OS=Psychromonas ingrahamii (strain 37) GN=gcvP PE=3 SV=1 101 1084 0.0E+00
sp|A1JPN3|GCSP_YERE8 Glycine dehydrogenase (decarboxylating) OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q13SR6|GCSP_BURXL Glycine dehydrogenase (decarboxylating) OS=Burkholderia xenovorans (strain LB400) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A6TDR5|GCSP_KLEP7 Glycine dehydrogenase (decarboxylating) OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|P49362|GCSPB_FLAPR Glycine dehydrogenase (decarboxylating) B, mitochondrial OS=Flaveria pringlei GN=GDCSPB PE=3 SV=1 103 1085 0.0E+00
sp|O49850|GCSP_FLAAN Glycine dehydrogenase (decarboxylating), mitochondrial OS=Flaveria anomala GN=GDCSP PE=3 SV=1 103 1085 0.0E+00
sp|A0M5D4|GCSP_GRAFK Glycine dehydrogenase (decarboxylating) OS=Gramella forsetii (strain KT0803) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|O49852|GCSP_FLATR Glycine dehydrogenase (decarboxylating), mitochondrial OS=Flaveria trinervia GN=GDCSPA PE=3 SV=1 103 1085 0.0E+00
sp|P49361|GCSPA_FLAPR Glycine dehydrogenase (decarboxylating) A, mitochondrial OS=Flaveria pringlei GN=GDCSPA PE=2 SV=1 103 1085 0.0E+00
sp|Q87DR1|GCSP_XYLFT Glycine dehydrogenase (decarboxylating) OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gcvP PE=3 SV=1 86 1079 0.0E+00
sp|B2UNH4|GCSP_AKKM8 Glycine dehydrogenase (decarboxylating) OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q2STK2|GCSP_BURTA Glycine dehydrogenase (decarboxylating) OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gcvP PE=3 SV=1 90 1080 0.0E+00
sp|Q9PDJ4|GCSP_XYLFA Glycine dehydrogenase (decarboxylating) OS=Xylella fastidiosa (strain 9a5c) GN=gcvP PE=3 SV=1 99 1079 0.0E+00
sp|Q9RTF5|GCSP_DEIRA Glycine dehydrogenase (decarboxylating) OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q5NZ93|GCSP_AROAE Glycine dehydrogenase (decarboxylating) OS=Aromatoleum aromaticum (strain EbN1) GN=gcvP PE=3 SV=1 92 1080 0.0E+00
sp|A7MR85|GCSP_CROS8 Glycine dehydrogenase (decarboxylating) OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B1JNS8|GCSP_YERPY Glycine dehydrogenase (decarboxylating) OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q666R7|GCSP_YERPS Glycine dehydrogenase (decarboxylating) OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A4TIA7|GCSP_YERPP Glycine dehydrogenase (decarboxylating) OS=Yersinia pestis (strain Pestoides F) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q1CEZ9|GCSP_YERPN Glycine dehydrogenase (decarboxylating) OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A9R4K8|GCSP_YERPG Glycine dehydrogenase (decarboxylating) OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q8ZHI8|GCSP_YERPE Glycine dehydrogenase (decarboxylating) OS=Yersinia pestis GN=gcvP PE=3 SV=3 99 1080 0.0E+00
sp|B2K0Q3|GCSP_YERPB Glycine dehydrogenase (decarboxylating) OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q1CB42|GCSP_YERPA Glycine dehydrogenase (decarboxylating) OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A7FF21|GCSP_YERP3 Glycine dehydrogenase (decarboxylating) OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B5XUD5|GCSP_KLEP3 Glycine dehydrogenase (decarboxylating) OS=Klebsiella pneumoniae (strain 342) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|P74416|GCSP_SYNY3 Glycine dehydrogenase (decarboxylating) OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gcvP PE=1 SV=1 106 1079 0.0E+00
sp|Q2SFI6|GCSP_HAHCH Glycine dehydrogenase (decarboxylating) OS=Hahella chejuensis (strain KCTC 2396) GN=gcvP PE=3 SV=1 93 1080 0.0E+00
sp|A9ACU3|GCSP_BURM1 Glycine dehydrogenase (decarboxylating) OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q486J6|GCSP1_COLP3 Glycine dehydrogenase (decarboxylating) 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gcvP1 PE=3 SV=1 103 1079 0.0E+00
sp|A4JA69|GCSP_BURVG Glycine dehydrogenase (decarboxylating) OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7N7E6|GCSP_ECOLU Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q5DZM3|GCSP_VIBF1 Glycine dehydrogenase (decarboxylating) OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B4EF26|GCSP_BURCJ Glycine dehydrogenase (decarboxylating) OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B1LDA3|GCSP_ECOSM Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B5EUH1|GCSP_VIBFM Glycine dehydrogenase (decarboxylating) OS=Vibrio fischeri (strain MJ11) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q1R7C8|GCSP_ECOUT Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain UTI89 / UPEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7MM89|GCSP_ECO45 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q8F937|GCSP_LEPIN Glycine dehydrogenase (decarboxylating) OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q47XG2|GCSP2_COLP3 Glycine dehydrogenase (decarboxylating) 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gcvP2 PE=3 SV=1 103 1079 0.0E+00
sp|B1YQQ1|GCSP_BURA4 Glycine dehydrogenase (decarboxylating) OS=Burkholderia ambifaria (strain MC40-6) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q72VI8|GCSP_LEPIC Glycine dehydrogenase (decarboxylating) OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|A3NF00|GCSP_BURP6 Glycine dehydrogenase (decarboxylating) OS=Burkholderia pseudomallei (strain 668) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7MZ55|GCSP_ECO81 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O81 (strain ED1a) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7UHV1|GCSP_ECO27 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|C3JYR1|GCSP_PSEFS Glycine dehydrogenase (decarboxylating) OS=Pseudomonas fluorescens (strain SBW25) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q0TDU9|GCSP_ECOL5 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q63PL2|GCSP_BURPS Glycine dehydrogenase (decarboxylating) OS=Burkholderia pseudomallei (strain K96243) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q3JY08|GCSP_BURP1 Glycine dehydrogenase (decarboxylating) OS=Burkholderia pseudomallei (strain 1710b) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A1V8N7|GCSP_BURMS Glycine dehydrogenase (decarboxylating) OS=Burkholderia mallei (strain SAVP1) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q62FN1|GCSP_BURMA Glycine dehydrogenase (decarboxylating) OS=Burkholderia mallei (strain ATCC 23344) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A2S6F6|GCSP_BURM9 Glycine dehydrogenase (decarboxylating) OS=Burkholderia mallei (strain NCTC 10229) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A3MQP3|GCSP_BURM7 Glycine dehydrogenase (decarboxylating) OS=Burkholderia mallei (strain NCTC 10247) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A1AF92|GCSP_ECOK1 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O1:K1 / APEC GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7NHW4|GCSP_ECO7I Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q32BW5|GCSP_SHIDS Glycine dehydrogenase (decarboxylating) OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q8FE67|GCSP_ECOL6 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gcvP PE=3 SV=3 103 1080 0.0E+00
sp|Q0BJI1|GCSP_BURCM Glycine dehydrogenase (decarboxylating) OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q46IC1|GCSP_PROMT Glycine dehydrogenase (decarboxylating) OS=Prochlorococcus marinus (strain NATL2A) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A5FMT0|GCSP_FLAJ1 Glycine dehydrogenase (decarboxylating) OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|B1JSZ2|GCSP_BURCC Glycine dehydrogenase (decarboxylating) OS=Burkholderia cenocepacia (strain MC0-3) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A0K321|GCSP_BURCH Glycine dehydrogenase (decarboxylating) OS=Burkholderia cenocepacia (strain HI2424) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q1BRE8|GCSP_BURCA Glycine dehydrogenase (decarboxylating) OS=Burkholderia cenocepacia (strain AU 1054) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B5YQ95|GCSP_ECO5E Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q8XD33|GCSP_ECO57 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O157:H7 GN=gcvP PE=3 SV=3 103 1080 0.0E+00
sp|Q8EIQ6|GCSP_SHEON Glycine dehydrogenase (decarboxylating) OS=Shewanella oneidensis (strain MR-1) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|P33195|GCSP_ECOLI Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain K12) GN=gcvP PE=1 SV=3 103 1080 0.0E+00
sp|B1XEJ0|GCSP_ECODH Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain K12 / DH10B) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|C5A0H5|GCSP_ECOBW Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q83QA2|GCSP_SHIFL Glycine dehydrogenase (decarboxylating) OS=Shigella flexneri GN=gcvP PE=3 SV=3 103 1080 0.0E+00
sp|Q0T0Z5|GCSP_SHIF8 Glycine dehydrogenase (decarboxylating) OS=Shigella flexneri serotype 5b (strain 8401) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A6WSL1|GCSP_SHEB8 Glycine dehydrogenase (decarboxylating) OS=Shewanella baltica (strain OS185) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|B6I736|GCSP_ECOSE Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain SE11) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7LF89|GCSP_ECO55 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain 55989 / EAEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B1IT99|GCSP_ECOLC Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A8A444|GCSP_ECOHS Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O9:H4 (strain HS) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B7LPB7|GCSP_ESCF3 Glycine dehydrogenase (decarboxylating) OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A9L330|GCSP_SHEB9 Glycine dehydrogenase (decarboxylating) OS=Shewanella baltica (strain OS195) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q1LHM2|GCSP_CUPMC Glycine dehydrogenase (decarboxylating) OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gcvP PE=3 SV=1 86 1080 0.0E+00
sp|B7LYG7|GCSP_ECO8A Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O8 (strain IAI1) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A7ZR12|GCSP_ECO24 Glycine dehydrogenase (decarboxylating) OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A3D085|GCSP_SHEB5 Glycine dehydrogenase (decarboxylating) OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q87I05|GCSP_VIBPA Glycine dehydrogenase (decarboxylating) OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A0L103|GCSP_SHESA Glycine dehydrogenase (decarboxylating) OS=Shewanella sp. (strain ANA-3) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q0HEX2|GCSP_SHESM Glycine dehydrogenase (decarboxylating) OS=Shewanella sp. (strain MR-4) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|B8EB45|GCSP_SHEB2 Glycine dehydrogenase (decarboxylating) OS=Shewanella baltica (strain OS223) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|A8APB1|GCSP_CITK8 Glycine dehydrogenase (decarboxylating) OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q07YC9|GCSP_SHEFN Glycine dehydrogenase (decarboxylating) OS=Shewanella frigidimarina (strain NCIMB 400) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|A1RFY8|GCSP_SHESW Glycine dehydrogenase (decarboxylating) OS=Shewanella sp. (strain W3-18-1) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|A4YAD8|GCSP_SHEPC Glycine dehydrogenase (decarboxylating) OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q39KU1|GCSP_BURL3 Glycine dehydrogenase (decarboxylating) OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q3YXW7|GCSP_SHISS Glycine dehydrogenase (decarboxylating) OS=Shigella sonnei (strain Ss046) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B6ES35|GCSP_ALISL Glycine dehydrogenase (decarboxylating) OS=Aliivibrio salmonicida (strain LFI1238) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q0HZ28|GCSP_SHESR Glycine dehydrogenase (decarboxylating) OS=Shewanella sp. (strain MR-7) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|A3QHI0|GCSP_SHELP Glycine dehydrogenase (decarboxylating) OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q16AX0|GCSP_ROSDO Glycine dehydrogenase (decarboxylating) OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q3AUM0|GCSP_SYNS9 Glycine dehydrogenase (decarboxylating) OS=Synechococcus sp. (strain CC9902) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q7V9K4|GCSP_PROMA Glycine dehydrogenase (decarboxylating) OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q4FMV1|GCSP_PELUB Glycine dehydrogenase (decarboxylating) OS=Pelagibacter ubique (strain HTCC1062) GN=gcvP PE=3 SV=1 95 1085 0.0E+00
sp|Q46VZ5|GCSP_CUPPJ Glycine dehydrogenase (decarboxylating) OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gcvP PE=3 SV=1 100 1080 0.0E+00
sp|C5BAT0|GCSP_EDWI9 Glycine dehydrogenase (decarboxylating) OS=Edwardsiella ictaluri (strain 93-146) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q8ZM76|GCSP_SALTY Glycine dehydrogenase (decarboxylating) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gcvP PE=3 SV=3 99 1080 0.0E+00
sp|C0PY26|GCSP_SALPC Glycine dehydrogenase (decarboxylating) OS=Salmonella paratyphi C (strain RKS4594) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A9N3N1|GCSP_SALPB Glycine dehydrogenase (decarboxylating) OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A2C5D4|GCSP_PROM1 Glycine dehydrogenase (decarboxylating) OS=Prochlorococcus marinus (strain NATL1A) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B2U0S0|GCSP_SHIB3 Glycine dehydrogenase (decarboxylating) OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q31WG4|GCSP_SHIBS Glycine dehydrogenase (decarboxylating) OS=Shigella boydii serotype 4 (strain Sb227) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q7V411|GCSP_PROMM Glycine dehydrogenase (decarboxylating) OS=Prochlorococcus marinus (strain MIT 9313) GN=gcvP PE=3 SV=1 106 1087 0.0E+00
sp|B4T548|GCSP_SALNS Glycine dehydrogenase (decarboxylating) OS=Salmonella newport (strain SL254) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A8GIR9|GCSP_SERP5 Glycine dehydrogenase (decarboxylating) OS=Serratia proteamaculans (strain 568) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B5RE14|GCSP_SALG2 Glycine dehydrogenase (decarboxylating) OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B5QXI0|GCSP_SALEP Glycine dehydrogenase (decarboxylating) OS=Salmonella enteritidis PT4 (strain P125109) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B5FUG6|GCSP_SALDC Glycine dehydrogenase (decarboxylating) OS=Salmonella dublin (strain CT_02021853) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q5FRY0|GCSP_GLUOX Glycine dehydrogenase (decarboxylating) OS=Gluconobacter oxydans (strain 621H) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|Q055P8|GCSP_LEPBL Glycine dehydrogenase (decarboxylating) OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gcvP PE=3 SV=1 81 1079 0.0E+00
sp|Q04PM7|GCSP_LEPBJ Glycine dehydrogenase (decarboxylating) OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gcvP PE=3 SV=1 81 1079 0.0E+00
sp|B5F5H7|GCSP_SALA4 Glycine dehydrogenase (decarboxylating) OS=Salmonella agona (strain SL483) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q8D7G7|GCSP_VIBVU Glycine dehydrogenase (decarboxylating) OS=Vibrio vulnificus (strain CMCP6) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A8FZK4|GCSP_SHESH Glycine dehydrogenase (decarboxylating) OS=Shewanella sediminis (strain HAW-EB3) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q7MEH9|GCSP_VIBVY Glycine dehydrogenase (decarboxylating) OS=Vibrio vulnificus (strain YJ016) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B4TGX3|GCSP_SALHS Glycine dehydrogenase (decarboxylating) OS=Salmonella heidelberg (strain SL476) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A8H7S9|GCSP_SHEPA Glycine dehydrogenase (decarboxylating) OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|A9MRH2|GCSP_SALAR Glycine dehydrogenase (decarboxylating) OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B0TSG5|GCSP_SHEHH Glycine dehydrogenase (decarboxylating) OS=Shewanella halifaxensis (strain HAW-EB4) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q8Z3X0|GCSP_SALTI Glycine dehydrogenase (decarboxylating) OS=Salmonella typhi GN=gcvP PE=3 SV=3 99 1080 0.0E+00
sp|Q1MG62|GCSP_RHIL3 Glycine dehydrogenase (decarboxylating) OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|A3P0U7|GCSP_BURP0 Glycine dehydrogenase (decarboxylating) OS=Burkholderia pseudomallei (strain 1106a) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q1QMW0|GCSP_NITHX Glycine dehydrogenase (decarboxylating) OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q6N344|GCSP_RHOPA Glycine dehydrogenase (decarboxylating) OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q48ME3|GCSP_PSE14 Glycine dehydrogenase (decarboxylating) OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|A7N5C4|GCSP_VIBCB Glycine dehydrogenase (decarboxylating) OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A2CDR0|GCSP_PROM3 Glycine dehydrogenase (decarboxylating) OS=Prochlorococcus marinus (strain MIT 9303) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A4WE55|GCSP_ENT38 Glycine dehydrogenase (decarboxylating) OS=Enterobacter sp. (strain 638) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|Q4ZXH2|GCSP_PSEU2 Glycine dehydrogenase (decarboxylating) OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q9I137|GCSP1_PSEAE Glycine dehydrogenase (decarboxylating) 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gcvP1 PE=3 SV=1 103 1084 0.0E+00
sp|Q92Q11|GCSP_RHIME Glycine dehydrogenase (decarboxylating) OS=Rhizobium meliloti (strain 1021) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q47D81|GCSP_DECAR Glycine dehydrogenase (decarboxylating) OS=Dechloromonas aromatica (strain RCB) GN=gcvP PE=3 SV=1 92 1079 0.0E+00
sp|Q887L5|GCSP_PSESM Glycine dehydrogenase (decarboxylating) OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q28L73|GCSP_JANSC Glycine dehydrogenase (decarboxylating) OS=Jannaschia sp. (strain CCS1) GN=gcvP PE=3 SV=1 106 1085 0.0E+00
sp|C3LUU7|GCSP_VIBCM Glycine dehydrogenase (decarboxylating) OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|A5EYY8|GCSP_VIBC3 Glycine dehydrogenase (decarboxylating) OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|A1S965|GCSP_SHEAM Glycine dehydrogenase (decarboxylating) OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gcvP PE=3 SV=1 96 1080 0.0E+00
sp|Q5F761|GCSP_NEIG1 Glycine dehydrogenase (decarboxylating) OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q6D974|GCSP_PECAS Glycine dehydrogenase (decarboxylating) OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|C6D8X1|GCSP_PECCP Glycine dehydrogenase (decarboxylating) OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B9JFK7|GCSP_AGRRK Glycine dehydrogenase (decarboxylating) OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q89I86|GCSP_BRADU Glycine dehydrogenase (decarboxylating) OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gcvP PE=3 SV=1 95 1080 0.0E+00
sp|B4F0N7|GCSP_PROMH Glycine dehydrogenase (decarboxylating) OS=Proteus mirabilis (strain HI4320) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|B4RN40|GCSP_NEIG2 Glycine dehydrogenase (decarboxylating) OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q3K7X5|GCSP1_PSEPF Glycine dehydrogenase (decarboxylating) 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=gcvP1 PE=3 SV=1 103 1079 0.0E+00
sp|Q5R192|GCSP_IDILO Glycine dehydrogenase (decarboxylating) OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gcvP PE=3 SV=1 90 1080 0.0E+00
sp|Q88CI9|GCSP2_PSEPK Glycine dehydrogenase (decarboxylating) 2 OS=Pseudomonas putida (strain KT2440) GN=gcvP2 PE=3 SV=1 90 1079 0.0E+00
sp|B5ZQP8|GCSP_RHILW Glycine dehydrogenase (decarboxylating) OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q2NRF0|GCSP_SODGM Glycine dehydrogenase (decarboxylating) OS=Sodalis glossinidius (strain morsitans) GN=gcvP PE=3 SV=1 99 1080 0.0E+00
sp|A1KV85|GCSP_NEIMF Glycine dehydrogenase (decarboxylating) OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A8LIH2|GCSP_DINSH Glycine dehydrogenase (decarboxylating) OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q9JT86|GCSP_NEIMA Glycine dehydrogenase (decarboxylating) OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A6U8Q3|GCSP_SINMW Glycine dehydrogenase (decarboxylating) OS=Sinorhizobium medicae (strain WSM419) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|A9M1P7|GCSP_NEIM0 Glycine dehydrogenase (decarboxylating) OS=Neisseria meningitidis serogroup C (strain 053442) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q3ST46|GCSP_NITWN Glycine dehydrogenase (decarboxylating) OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A4YXQ9|GCSP_BRASO Glycine dehydrogenase (decarboxylating) OS=Bradyrhizobium sp. (strain ORS278) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A5EMM2|GCSP_BRASB Glycine dehydrogenase (decarboxylating) OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|A4VRT4|GCSP_PSEU5 Glycine dehydrogenase (decarboxylating) OS=Pseudomonas stutzeri (strain A1501) GN=gcvP PE=3 SV=1 98 1079 0.0E+00
sp|Q4K416|GCSP2_PSEF5 Glycine dehydrogenase (decarboxylating) 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gcvP2 PE=3 SV=2 98 1080 0.0E+00
sp|Q827D7|GCSP_STRAW Glycine dehydrogenase (decarboxylating) OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gcvP PE=3 SV=2 103 1079 0.0E+00
sp|A0QGN2|GCSP_MYCA1 Glycine dehydrogenase (decarboxylating) OS=Mycobacterium avium (strain 104) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q9AK84|GCSP_STRCO Glycine dehydrogenase (decarboxylating) OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q9HTX7|GCSP2_PSEAE Glycine dehydrogenase (decarboxylating) 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gcvP2 PE=3 SV=1 103 1080 0.0E+00
sp|Q2K813|GCSP_RHIEC Glycine dehydrogenase (decarboxylating) OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q73ZQ6|GCSP_MYCPA Glycine dehydrogenase (decarboxylating) OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|B9JWI2|GCSP_AGRVS Glycine dehydrogenase (decarboxylating) OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q7N199|GCSP_PHOLL Glycine dehydrogenase (decarboxylating) OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q07R90|GCSP_RHOP5 Glycine dehydrogenase (decarboxylating) OS=Rhodopseudomonas palustris (strain BisA53) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|P9WN53|GCSP_MYCTU Probable glycine dehydrogenase (decarboxylating) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gcvP PE=1 SV=1 103 1079 0.0E+00
sp|P9WN52|GCSP_MYCTO Probable glycine dehydrogenase (decarboxylating) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|A5U3J9|GCSP_MYCTA Glycine dehydrogenase (decarboxylating) OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q7NSJ5|GCSP_CHRVO Glycine dehydrogenase (decarboxylating) OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gcvP PE=3 SV=1 95 1079 0.0E+00
sp|B3PP20|GCSP_RHIE6 Glycine dehydrogenase (decarboxylating) OS=Rhizobium etli (strain CIAT 652) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|B1W4G3|GCSP_STRGG Glycine dehydrogenase (decarboxylating) OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gcvP PE=3 SV=1 91 1079 0.0E+00
sp|Q3K4Z1|GCSP2_PSEPF Glycine dehydrogenase (decarboxylating) 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=gcvP2 PE=3 SV=1 98 1080 0.0E+00
sp|A4WUX2|GCSP_RHOS5 Glycine dehydrogenase (decarboxylating) OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q21HU3|GCSP_SACD2 Glycine dehydrogenase (decarboxylating) OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gcvP PE=3 SV=1 103 1084 0.0E+00
sp|B9KNU3|GCSP_RHOSK Glycine dehydrogenase (decarboxylating) OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q3J4D4|GCSP_RHOS4 Glycine dehydrogenase (decarboxylating) OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|A3PI15|GCSP_RHOS1 Glycine dehydrogenase (decarboxylating) OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q8UFD6|GCSP_AGRFC Glycine dehydrogenase (decarboxylating) OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gcvP PE=3 SV=1 106 1079 0.0E+00
sp|Q8XU98|GCSP_RALSO Glycine dehydrogenase (decarboxylating) OS=Ralstonia solanacearum (strain GMI1000) GN=gcvP PE=3 SV=1 100 1080 0.0E+00
sp|B2UG82|GCSP_RALPJ Glycine dehydrogenase (decarboxylating) OS=Ralstonia pickettii (strain 12J) GN=gcvP PE=3 SV=1 100 1080 0.0E+00
sp|Q1QCL7|GCSP_PSYCK Glycine dehydrogenase (decarboxylating) OS=Psychrobacter cryohalolentis (strain K5) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|B4SS67|GCSP_STRM5 Glycine dehydrogenase (decarboxylating) OS=Stenotrophomonas maltophilia (strain R551-3) GN=gcvP PE=3 SV=1 91 1079 0.0E+00
sp|B2FQE7|GCSP_STRMK Glycine dehydrogenase (decarboxylating) OS=Stenotrophomonas maltophilia (strain K279a) GN=gcvP PE=3 SV=1 91 1079 0.0E+00
sp|Q8G9M2|GCSP_RHOFA Glycine dehydrogenase (decarboxylating) (Fragment) OS=Rhodococcus fascians GN=gcvP PE=3 SV=1 96 1079 0.0E+00
sp|A5GWN4|GCSP_SYNR3 Glycine dehydrogenase (decarboxylating) OS=Synechococcus sp. (strain RCC307) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q4FTK9|GCSP_PSYA2 Glycine dehydrogenase (decarboxylating) OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|C5CRW8|GCSP_VARPS Glycine dehydrogenase (decarboxylating) OS=Variovorax paradoxus (strain S110) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|C5BNY8|GCSP_TERTT Glycine dehydrogenase (decarboxylating) OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|Q98LT6|GCSP_RHILO Glycine dehydrogenase (decarboxylating) OS=Rhizobium loti (strain MAFF303099) GN=gcvP PE=3 SV=1 103 1080 0.0E+00
sp|P62921|GCSP_BRUME Glycine dehydrogenase (decarboxylating) OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|Q6G2F1|GCSP_BARHE Glycine dehydrogenase (decarboxylating) OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|C0RLN1|GCSP_BRUMB Glycine dehydrogenase (decarboxylating) OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|Q8A8M0|GCSP_BACTN Glycine dehydrogenase (decarboxylating) OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gcvP PE=3 SV=1 106 1074 0.0E+00
sp|P62920|GCSP_BRUAB Glycine dehydrogenase (decarboxylating) OS=Brucella abortus biovar 1 (strain 9-941) GN=gcvP PE=3 SV=2 103 1078 0.0E+00
sp|Q2YKX9|GCSP_BRUA2 Glycine dehydrogenase (decarboxylating) OS=Brucella abortus (strain 2308) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|B2SAU5|GCSP_BRUA1 Glycine dehydrogenase (decarboxylating) OS=Brucella abortus (strain S19) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|A9WZ23|GCSP_BRUSI Glycine dehydrogenase (decarboxylating) OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|Q8FVU9|GCSP_BRUSU Glycine dehydrogenase (decarboxylating) OS=Brucella suis biovar 1 (strain 1330) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|A5VV25|GCSP_BRUO2 Glycine dehydrogenase (decarboxylating) OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|Q6FYZ7|GCSP_BARQU Glycine dehydrogenase (decarboxylating) OS=Bartonella quintana (strain Toulouse) GN=gcvP PE=3 SV=1 99 1078 0.0E+00
sp|A9MC11|GCSP_BRUC2 Glycine dehydrogenase (decarboxylating) OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gcvP PE=3 SV=1 103 1078 0.0E+00
sp|Q5LDN2|GCSP_BACFN Glycine dehydrogenase (decarboxylating) OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gcvP PE=3 SV=1 106 1075 0.0E+00
sp|Q64UQ7|GCSP_BACFR Glycine dehydrogenase (decarboxylating) OS=Bacteroides fragilis (strain YCH46) GN=gcvP PE=3 SV=1 106 1075 0.0E+00
sp|Q6A9R8|GCSP_PROAC Glycine dehydrogenase (decarboxylating) OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gcvP PE=3 SV=1 103 1079 0.0E+00
sp|Q83GV1|GCSP_TROWT Glycine dehydrogenase (decarboxylating) OS=Tropheryma whipplei (strain Twist) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q83IA7|GCSP_TROW8 Glycine dehydrogenase (decarboxylating) OS=Tropheryma whipplei (strain TW08/27) GN=gcvP PE=3 SV=1 106 1080 0.0E+00
sp|Q88P65|GCSP1_PSEPK Glycine dehydrogenase (decarboxylating) 1 OS=Pseudomonas putida (strain KT2440) GN=gcvP1 PE=3 SV=1 588 1079 7.0E-172
sp|Q3BW89|GCSP_XANC5 Glycine dehydrogenase (decarboxylating) OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gcvP PE=3 SV=1 588 1079 4.0E-171
sp|Q2P021|GCSP_XANOM Glycine dehydrogenase (decarboxylating) OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gcvP PE=3 SV=1 588 1079 2.0E-166
sp|Q8PN59|GCSP_XANAC Glycine dehydrogenase (decarboxylating) OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gcvP PE=3 SV=1 589 1079 3.0E-165
sp|C1APA9|GCSP_MYCBT Glycine dehydrogenase (decarboxylating) OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=gcvP PE=3 SV=1 594 1079 2.0E-163
sp|A1KJP4|GCSP_MYCBP Glycine dehydrogenase (decarboxylating) OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gcvP PE=3 SV=1 594 1079 2.0E-163
sp|Q7VET8|GCSP_MYCBO Glycine dehydrogenase (decarboxylating) OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gcvP PE=3 SV=1 594 1079 2.0E-163
sp|A4TA90|GCSP_MYCGI Glycine dehydrogenase (decarboxylating) OS=Mycobacterium gilvum (strain PYR-GCK) GN=gcvP PE=3 SV=1 589 1079 1.0E-162
sp|O32915|GCSP_MYCLE Glycine dehydrogenase (decarboxylating) OS=Mycobacterium leprae (strain TN) GN=gcvP PE=3 SV=1 589 1079 2.0E-157
sp|B8ZSN5|GCSP_MYCLB Glycine dehydrogenase (decarboxylating) OS=Mycobacterium leprae (strain Br4923) GN=gcvP PE=3 SV=1 589 1079 2.0E-157
sp|Q5YWV4|GCSP_NOCFA Glycine dehydrogenase (decarboxylating) OS=Nocardia farcinica (strain IFM 10152) GN=gcvP PE=3 SV=1 594 1079 5.0E-157
sp|A4TA90|GCSP_MYCGI Glycine dehydrogenase (decarboxylating) OS=Mycobacterium gilvum (strain PYR-GCK) GN=gcvP PE=3 SV=1 103 464 3.0E-96
sp|Q8PBK7|GCSP_XANCP Glycine dehydrogenase (decarboxylating) OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gcvP PE=3 SV=1 99 464 7.0E-96
sp|Q4URZ4|GCSP_XANC8 Glycine dehydrogenase (decarboxylating) OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gcvP PE=3 SV=1 99 464 7.0E-96
sp|O32915|GCSP_MYCLE Glycine dehydrogenase (decarboxylating) OS=Mycobacterium leprae (strain TN) GN=gcvP PE=3 SV=1 92 464 2.0E-94
sp|B8ZSN5|GCSP_MYCLB Glycine dehydrogenase (decarboxylating) OS=Mycobacterium leprae (strain Br4923) GN=gcvP PE=3 SV=1 92 464 2.0E-94
sp|Q3BW89|GCSP_XANC5 Glycine dehydrogenase (decarboxylating) OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gcvP PE=3 SV=1 99 491 4.0E-94
sp|Q8PN59|GCSP_XANAC Glycine dehydrogenase (decarboxylating) OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gcvP PE=3 SV=1 99 491 4.0E-94
sp|Q2P021|GCSP_XANOM Glycine dehydrogenase (decarboxylating) OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gcvP PE=3 SV=1 99 464 9.0E-94
sp|A7HLP1|GCSPB_FERNB Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=gcvPB PE=3 SV=1 575 1002 2.0E-91
sp|C1APA9|GCSP_MYCBT Glycine dehydrogenase (decarboxylating) OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=gcvP PE=3 SV=1 103 477 2.0E-90
sp|A1KJP4|GCSP_MYCBP Glycine dehydrogenase (decarboxylating) OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gcvP PE=3 SV=1 103 477 2.0E-90
sp|Q7VET8|GCSP_MYCBO Glycine dehydrogenase (decarboxylating) OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gcvP PE=3 SV=1 103 477 2.0E-90
sp|Q2YCK3|GCSPB_NITMU Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gcvPB PE=3 SV=1 609 1048 2.0E-86
sp|Q88P65|GCSP1_PSEPK Glycine dehydrogenase (decarboxylating) 1 OS=Pseudomonas putida (strain KT2440) GN=gcvP1 PE=3 SV=1 103 464 9.0E-86
sp|C5CF44|GCSPB_KOSOT Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=gcvPB PE=3 SV=1 609 999 3.0E-84
sp|Q5YWV4|GCSP_NOCFA Glycine dehydrogenase (decarboxylating) OS=Nocardia farcinica (strain IFM 10152) GN=gcvP PE=3 SV=1 101 477 8.0E-84
sp|Q5WF32|GCSPB_BACSK Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus clausii (strain KSM-K16) GN=gcvPB PE=3 SV=1 609 1002 2.0E-82
sp|Q9WY57|GCSPB_THEMA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gcvPB PE=3 SV=1 609 1021 2.0E-82
sp|A8F8M6|GCSPB_PSELT Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gcvPB PE=3 SV=1 578 1021 2.0E-82
sp|B1YLN8|GCSPB_EXIS2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gcvPB PE=3 SV=1 609 1021 2.0E-82
sp|A4SCK8|GCSPB_CHLPM Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gcvPB PE=3 SV=1 610 1002 2.0E-82
sp|Q9K936|GCSPB_BACHD Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gcvPB PE=3 SV=1 609 1020 5.0E-82
sp|C1L2Q6|GCSPB_LISMC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gcvPB PE=3 SV=1 609 1021 6.0E-82
sp|Q71ZX2|GCSPB_LISMF Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gcvPB PE=3 SV=2 609 1021 7.0E-82
sp|B8DFX8|GCSPB_LISMH Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gcvPB PE=3 SV=1 609 1021 8.0E-82
sp|Q8Y7D3|GCSPB_LISMO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gcvPB PE=3 SV=1 609 1021 9.0E-82
sp|B1L9T8|GCSPB_THESQ Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermotoga sp. (strain RQ2) GN=gcvPB PE=3 SV=1 609 1021 2.0E-81
sp|Q8KAN3|GCSPB_CHLTE Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gcvPB PE=3 SV=1 575 999 2.0E-81
sp|Q3AQ15|GCSPB_CHLCH Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Chlorobium chlorochromatii (strain CaD3) GN=gcvPB PE=3 SV=1 609 1023 3.0E-81
sp|A5IKK7|GCSPB_THEP1 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gcvPB PE=3 SV=1 609 1021 1.0E-80
sp|B7IF24|GCSPB_THEAB Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermosipho africanus (strain TCF52B) GN=gcvPB PE=3 SV=1 609 1002 1.0E-80
sp|Q92C04|GCSPB_LISIN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gcvPB PE=3 SV=1 609 1021 2.0E-80
sp|Q5HP14|GCSPB_STAEQ Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gcvPB PE=3 SV=1 609 999 2.0E-80
sp|A6LP69|GCSPB_THEM4 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gcvPB PE=3 SV=1 609 1021 2.0E-80
sp|A0AIF1|GCSPB_LISW6 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gcvPB PE=3 SV=1 609 1021 2.0E-80
sp|B9K6R4|GCSPB_THENN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gcvPB PE=3 SV=1 609 1020 2.0E-80
sp|A7GSN6|GCSPB_BACCN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gcvPB PE=3 SV=1 609 1047 6.0E-80
sp|Q8CMM1|GCSPB_STAES Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gcvPB PE=3 SV=1 609 999 8.0E-80
sp|Q4L6N5|GCSPB_STAHJ Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gcvPB PE=3 SV=1 609 999 2.0E-79
sp|Q65HG1|GCSPB_BACLD Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gcvPB PE=3 SV=1 609 1021 3.0E-79
sp|B8GN14|GCSPB_THISH Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gcvPB PE=3 SV=1 582 1024 4.0E-79
sp|B7IXL2|GCSPB_BACC2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain G9842) GN=gcvPB PE=3 SV=1 609 1021 5.0E-79
sp|B7HB98|GCSPB_BACC4 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain B4264) GN=gcvPB PE=3 SV=1 609 1021 8.0E-79
sp|A8MEG7|GCSPB_ALKOO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=gcvPB PE=3 SV=1 609 1020 1.0E-78
sp|A9VH10|GCSPB_BACWK Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=gcvPB PE=3 SV=1 609 1021 1.0E-78
sp|A7Z6M2|GCSPB_BACMF Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gcvPB PE=3 SV=1 609 1021 1.0E-78
sp|Q49XX9|GCSPB_STAS1 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gcvPB PE=3 SV=1 609 1027 1.0E-78
sp|P62029|GCSPB_BACC1 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gcvPB PE=3 SV=1 609 1021 1.0E-78
sp|B9IXL7|GCSPB_BACCQ Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain Q1) GN=gcvPB PE=3 SV=1 609 1021 1.0E-78
sp|B7HNY9|GCSPB_BACC7 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain AH187) GN=gcvPB PE=3 SV=1 609 1021 1.0E-78
sp|Q2YSZ4|GCSPB_STAAB Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gcvPB PE=3 SV=1 609 999 1.0E-78
sp|Q6HDT8|GCSPB_BACHK Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|Q634V8|GCSPB_BACCZ Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain ZK / E33L) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|C1ERU8|GCSPB_BACC3 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain 03BB102) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|B7JMU9|GCSPB_BACC0 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain AH820) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|Q81M08|GCSPB_BACAN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus anthracis GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|C3LKQ2|GCSPB_BACAC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|C3P8D3|GCSPB_BACAA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus anthracis (strain A0248) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|A0RIK9|GCSPB_BACAH Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=gcvPB PE=3 SV=1 609 1021 2.0E-78
sp|Q3SMC1|GCSPB_THIDA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gcvPB PE=3 SV=1 588 999 2.0E-78
sp|Q818M5|GCSPB_BACCR Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gcvPB PE=3 SV=1 609 1021 3.0E-78
sp|Q83B09|GCSPB_COXBU Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gcvPB PE=3 SV=1 609 1022 3.0E-78
sp|A9NA76|GCSPB_COXBR Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gcvPB PE=3 SV=1 609 1022 3.0E-78
sp|A9KC20|GCSPB_COXBN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gcvPB PE=3 SV=1 609 1022 3.0E-78
sp|Q8TZJ2|GCSPB_PYRFU Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gcvPB PE=3 SV=1 582 1023 4.0E-78
sp|B6J4T8|GCSPB_COXB1 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Coxiella burnetii (strain CbuK_Q154) GN=gcvPB PE=3 SV=1 609 1022 5.0E-78
sp|Q6GGG4|GCSPB_STAAR Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=gcvPB PE=3 SV=1 609 999 5.0E-78
sp|P99168|GCSPB_STAAN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain N315) GN=gcvPB PE=1 SV=1 609 999 5.0E-78
sp|P64219|GCSPB_STAAM Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gcvPB PE=3 SV=1 609 999 5.0E-78
sp|A5IT63|GCSPB_STAA9 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain JH9) GN=gcvPB PE=3 SV=1 609 999 5.0E-78
sp|A6U206|GCSPB_STAA2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain JH1) GN=gcvPB PE=3 SV=1 609 999 5.0E-78
sp|A7X2R9|GCSPB_STAA1 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gcvPB PE=3 SV=1 609 999 5.0E-78
sp|P54377|GCSPB_BACSU Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Bacillus subtilis (strain 168) GN=gcvPB PE=3 SV=1 609 1021 6.0E-78
sp|B6J2H6|GCSPB_COXB2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Coxiella burnetii (strain CbuG_Q212) GN=gcvPB PE=3 SV=1 609 1022 6.0E-78
sp|Q8NWD0|GCSPB_STAAW Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain MW2) GN=gcvPB PE=3 SV=1 609 999 2.0E-77
sp|A8Z474|GCSPB_STAAT Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gcvPB PE=3 SV=1 609 999 2.0E-77
sp|Q6G931|GCSPB_STAAS Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain MSSA476) GN=gcvPB PE=3 SV=1 609 999 2.0E-77
sp|Q2FY35|GCSPB_STAA8 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=gcvPB PE=3 SV=1 609 999 2.0E-77
sp|Q2FGI7|GCSPB_STAA3 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain USA300) GN=gcvPB PE=3 SV=1 609 999 2.0E-77
sp|A5I9T3|GCSPB_LEGPC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Legionella pneumophila (strain Corby) GN=gcvPB PE=3 SV=1 609 1021 3.0E-77
sp|Q5X0A8|GCSPB_LEGPL Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Legionella pneumophila (strain Lens) GN=gcvPB PE=3 SV=1 609 1021 3.0E-77
sp|Q9HII2|GCSPB_THEAC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gcvPB PE=3 SV=1 567 1010 4.0E-77
sp|Q5X8W5|GCSPB_LEGPA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Legionella pneumophila (strain Paris) GN=gcvPB PE=3 SV=1 609 1021 7.0E-77
sp|A6QH79|GCSPB_STAAE Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain Newman) GN=gcvPB PE=3 SV=1 609 999 8.0E-77
sp|Q5HFM4|GCSPB_STAAC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylococcus aureus (strain COL) GN=gcvPB PE=3 SV=1 609 999 8.0E-77
sp|Q60BW5|GCSPB_METCA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gcvPB PE=3 SV=1 609 1002 9.0E-77
sp|Q5ZZ97|GCSPB_LEGPH Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gcvPB PE=3 SV=1 609 1021 1.0E-76
sp|B1HSN5|GCSPB_LYSSC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=gcvPB PE=3 SV=1 609 1021 1.0E-76
sp|Q8CXE1|GCSPB_OCEIH Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gcvPB PE=3 SV=1 609 1002 1.0E-76
sp|C5A7J0|GCSPB_THEGJ Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gcvPB PE=3 SV=1 588 1023 2.0E-76
sp|Q8RCW2|GCSPB_CALS4 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gcvPB PE=3 SV=1 609 1021 5.0E-76
sp|B3QS77|GCSPB_CHLT3 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gcvPB PE=3 SV=1 610 999 6.0E-76
sp|Q82WQ3|GCSPB_NITEU Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gcvPB PE=3 SV=1 588 1020 7.0E-76
sp|A4J2F9|GCSPB_DESRM Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Desulfotomaculum reducens (strain MI-1) GN=gcvPB PE=3 SV=1 609 1002 3.0E-75
sp|P62031|GCSPB_TREDE Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gcvPB PE=3 SV=1 609 999 4.0E-75
sp|Q0AEQ0|GCSPB_NITEC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Nitrosomonas eutropha (strain C91) GN=gcvPB PE=3 SV=1 588 1020 4.0E-75
sp|Q9UXT1|GCSPB_PYRAB Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gcvPB PE=3 SV=1 609 1023 5.0E-75
sp|B6YT12|GCSPB_THEON Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermococcus onnurineus (strain NA1) GN=gcvPB PE=3 SV=1 609 1023 6.0E-75
sp|Q3J846|GCSPB_NITOC Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gcvPB PE=3 SV=1 609 1021 9.0E-75
sp|A4IZK5|GCSPB_FRATW Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gcvPB PE=3 SV=1 608 997 1.0E-74
sp|B2SFM4|GCSPB_FRATM Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gcvPB PE=3 SV=1 608 997 1.0E-74
sp|O57709|GCSPB_PYRHO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gcvPB PE=3 SV=1 609 1023 1.0E-74
sp|A1BJA7|GCSPB_CHLPD Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gcvPB PE=3 SV=1 575 999 2.0E-74
sp|A0Q588|GCSPB_FRATN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Francisella tularensis subsp. novicida (strain U112) GN=gcvPB PE=3 SV=1 608 997 3.0E-74
sp|B0TZJ5|GCSPB_FRAP2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gcvPB PE=3 SV=1 585 997 4.0E-74
sp|Q5JGX6|GCSPB_THEKO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gcvPB PE=3 SV=1 588 1023 1.0E-73
sp|C0ZBW7|GCSPB_BREBN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gcvPB PE=3 SV=1 609 1021 2.0E-73
sp|Q97C04|GCSPB_THEVO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gcvPB PE=3 SV=1 609 1010 2.0E-73
sp|B1GYV8|GCSPB_UNCTG Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gcvPB PE=3 SV=1 579 1019 4.0E-73
sp|Q0AVH9|GCSPB_SYNWW Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gcvPB PE=3 SV=1 609 1021 1.0E-72
sp|B4SB96|GCSPB_PELPB Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gcvPB PE=3 SV=1 609 1001 2.0E-72
sp|B3EEC8|GCSPB_CHLL2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gcvPB PE=3 SV=1 575 999 4.0E-72
sp|Q7UNH1|GCSPB_RHOBA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gcvPB PE=3 SV=1 609 1003 1.0E-70
sp|Q8CXE0|GCSPA_OCEIH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gcvPA PE=3 SV=1 105 486 8.0E-70
sp|B4S3N4|GCSPB_PROA2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gcvPB PE=3 SV=1 585 999 9.0E-70
sp|C3NE26|GCSPB_SULIY Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=gcvPB PE=3 SV=1 609 1009 2.0E-69
sp|C3NHN7|GCSPB_SULIN Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=gcvPB PE=3 SV=1 609 1009 2.0E-69
sp|C3MUU9|GCSPB_SULIM Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=gcvPB PE=3 SV=1 609 1009 2.0E-69
sp|C3MPT6|GCSPB_SULIL Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=gcvPB PE=3 SV=1 609 1009 2.0E-69
sp|C4KH28|GCSPB_SULIK Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=gcvPB PE=3 SV=1 609 1009 2.0E-69
sp|C3N5G2|GCSPB_SULIA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus islandicus (strain M.16.27) GN=gcvPB PE=3 SV=1 609 1009 2.0E-69
sp|Q8Y7D4|GCSPA_LISMO Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gcvPA PE=3 SV=1 105 486 2.0E-69
sp|A0AIF0|GCSPA_LISW6 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gcvPA PE=3 SV=1 105 486 5.0E-69
sp|A4IQV4|GCSPA_GEOTN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gcvPA PE=3 SV=1 105 483 7.0E-69
sp|Q92C05|GCSPA_LISIN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gcvPA PE=3 SV=1 105 486 7.0E-69
sp|Q71ZX3|GCSPA_LISMF Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gcvPA PE=3 SV=1 105 486 9.0E-69
sp|B8DFX9|GCSPA_LISMH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gcvPA PE=3 SV=1 105 486 1.0E-68
sp|C1L2Q5|GCSPA_LISMC Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gcvPA PE=3 SV=1 105 486 1.0E-68
sp|O67740|GCSPB_AQUAE Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Aquifex aeolicus (strain VF5) GN=gcvPB PE=3 SV=1 609 1020 3.0E-68
sp|B9E6R9|GCSPA_MACCJ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Macrococcus caseolyticus (strain JCSC5402) GN=gcvPA PE=3 SV=1 105 489 3.0E-68
sp|C5D4A1|GCSPA_GEOSW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Geobacillus sp. (strain WCH70) GN=gcvPA PE=3 SV=1 105 485 5.0E-68
sp|P54376|GCSPA_BACSU Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus subtilis (strain 168) GN=gcvPA PE=3 SV=2 105 485 8.0E-67
sp|A7Z6M3|GCSPA_BACMF Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gcvPA PE=3 SV=1 105 486 8.0E-67
sp|Q5KX77|GCSPA_GEOKA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Geobacillus kaustophilus (strain HTA426) GN=gcvPA PE=3 SV=1 105 483 1.0E-66
sp|A7GSN7|GCSPA_BACCN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gcvPA PE=3 SV=1 105 486 2.0E-66
sp|Q65HG0|GCSPA_BACLD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gcvPA PE=3 SV=1 105 486 3.0E-66
sp|A9VH11|GCSPA_BACWK Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=gcvPA PE=3 SV=1 105 485 1.0E-65
sp|Q818M4|GCSPA_BACCR Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gcvPA PE=3 SV=1 105 485 1.0E-65
sp|B7HB99|GCSPA_BACC4 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain B4264) GN=gcvPA PE=3 SV=1 105 485 1.0E-65
sp|B7IXL3|GCSPA_BACC2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain G9842) GN=gcvPA PE=3 SV=1 105 485 1.0E-65
sp|Q730W2|GCSPA_BACC1 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gcvPA PE=3 SV=1 105 485 1.0E-65
sp|P62030|GCSPB_THET2 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gcvPB PE=3 SV=1 610 1002 2.0E-65
sp|B9IXL8|GCSPA_BACCQ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain Q1) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|B7HNZ0|GCSPA_BACC7 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain AH187) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|Q634V7|GCSPA_BACCZ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|C1ERU9|GCSPA_BACC3 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain 03BB102) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|B7JMV0|GCSPA_BACC0 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus cereus (strain AH820) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|Q81M07|GCSPA_BACAN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus anthracis GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|A0RIL0|GCSPA_BACAH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|C3LKQ3|GCSPA_BACAC Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|C3P8D4|GCSPA_BACAA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus anthracis (strain A0248) GN=gcvPA PE=3 SV=1 105 485 2.0E-65
sp|Q5SKW7|GCSPB_THET8 Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gcvPB PE=1 SV=1 610 1002 2.0E-65
sp|Q3AET5|GCSPA_CARHZ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gcvPA PE=3 SV=1 110 484 4.0E-65
sp|Q9A354|GCSPB_CAUCR Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gcvPB PE=3 SV=1 609 990 4.0E-65
sp|C0ZBW6|GCSPA_BREBN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gcvPA PE=3 SV=1 105 486 6.0E-65
sp|Q5WF31|GCSPA_BACSK Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus clausii (strain KSM-K16) GN=gcvPA PE=3 SV=1 105 485 1.0E-64
sp|Q6HDT7|GCSPA_BACHK Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gcvPA PE=3 SV=1 105 485 1.0E-64
sp|Q4L6N6|GCSPA_STAHJ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gcvPA PE=3 SV=1 105 489 1.0E-64
sp|B1HSN6|GCSPA_LYSSC Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=gcvPA PE=3 SV=1 105 486 6.0E-64
sp|A8FF40|GCSPA_BACP2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus pumilus (strain SAFR-032) GN=gcvPA PE=3 SV=1 105 483 6.0E-64
sp|Q6GGG3|GCSPA_STAAR Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=gcvPA PE=3 SV=1 102 489 6.0E-64
sp|Q5HFM3|GCSPA_STAAC Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain COL) GN=gcvPA PE=3 SV=1 105 489 1.0E-63
sp|Q6G930|GCSPA_STAAS Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=gcvPA PE=3 SV=1 102 489 2.0E-63
sp|P64218|GCSPA_STAAN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain N315) GN=gcvPA PE=1 SV=1 105 489 2.0E-63
sp|P64217|GCSPA_STAAM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gcvPA PE=3 SV=1 105 489 2.0E-63
sp|A5IT64|GCSPA_STAA9 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain JH9) GN=gcvPA PE=3 SV=1 105 489 2.0E-63
sp|A6U207|GCSPA_STAA2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain JH1) GN=gcvPA PE=3 SV=1 105 489 2.0E-63
sp|A7X2S0|GCSPA_STAA1 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gcvPA PE=3 SV=1 105 489 2.0E-63
sp|Q8CMM0|GCSPA_STAES Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gcvPA PE=3 SV=1 105 485 2.0E-63
sp|Q5HP13|GCSPA_STAEQ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gcvPA PE=3 SV=1 105 485 2.0E-63
sp|Q8NWC9|GCSPA_STAAW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain MW2) GN=gcvPA PE=3 SV=1 105 489 3.0E-63
sp|Q2FY34|GCSPA_STAA8 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=gcvPA PE=3 SV=1 105 489 3.0E-63
sp|Q2FGI6|GCSPA_STAA3 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus aureus (strain USA300) GN=gcvPA PE=3 SV=1 105 489 3.0E-63
sp|B1YLN7|GCSPA_EXIS2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gcvPA PE=3 SV=1 105 485 4.0E-63
sp|Q972C0|GCSPB_SULTO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gcvPB PE=3 SV=1 578 996 8.0E-63
sp|Q97ZI9|GCSPB_SULSO Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gcvPB PE=3 SV=1 609 996 1.0E-62
sp|B9DNN6|GCSPA_STACT Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus carnosus (strain TM300) GN=gcvPA PE=3 SV=1 105 485 1.0E-62
sp|O67193|GCSPA_AQUAE Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Aquifex aeolicus (strain VF5) GN=gcvPA PE=3 SV=1 107 484 3.0E-62
sp|Q2RH48|GCSPA_MOOTA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=gcvPA PE=3 SV=1 152 476 4.0E-62
sp|Q49XY0|GCSPA_STAS1 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gcvPA PE=3 SV=1 105 489 4.0E-62
sp|Q9HPK0|GCSPB_HALSA Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gcvPB PE=3 SV=1 610 993 7.0E-62
sp|A3DNK0|GCSPB_STAMF Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=gcvPB PE=3 SV=1 609 996 4.0E-61
sp|B7GHD3|GCSPA_ANOFW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gcvPA PE=3 SV=1 105 472 6.0E-61
sp|Q9YA18|GCSPB_AERPE Probable glycine dehydrogenase (decarboxylating) subunit 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gcvPB PE=3 SV=2 609 1009 7.0E-61
sp|A4J2F8|GCSPA_DESRM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfotomaculum reducens (strain MI-1) GN=gcvPA PE=3 SV=1 113 483 7.0E-61
sp|Q9K935|GCSPA_BACHD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gcvPA PE=3 SV=1 105 485 2.0E-60
sp|B6YT11|GCSPA_THEON Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermococcus onnurineus (strain NA1) GN=gcvPA PE=3 SV=1 106 476 2.0E-60
sp|Q5JGX5|GCSPA_THEKO Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gcvPA PE=3 SV=1 106 476 2.0E-60
sp|Q1INU0|GCSPA_KORVE Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Koribacter versatilis (strain Ellin345) GN=gcvPA PE=3 SV=1 106 488 2.0E-60
sp|O57708|GCSPA_PYRHO Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gcvPA PE=3 SV=1 107 476 1.0E-59
sp|B4S5J4|GCSPA_PROA2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gcvPA PE=3 SV=1 108 474 2.0E-59
sp|Q9UXT0|GCSPA_PYRAB Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gcvPA PE=3 SV=1 106 476 1.0E-58
sp|B3QUT6|GCSPA_CHLT3 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gcvPA PE=3 SV=1 114 474 3.0E-58
sp|B8D1D5|GCSPA_HALOH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gcvPA PE=3 SV=1 113 488 1.0E-57
sp|Q8RCW1|GCSPA_CALS4 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gcvPA PE=3 SV=1 113 489 4.0E-57
sp|Q3APU1|GCSPA_CHLCH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=gcvPA PE=3 SV=1 108 477 2.0E-56
sp|C1F935|GCSPA_ACIC5 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gcvPA PE=3 SV=1 106 471 7.0E-56
sp|Q24TH5|GCSPA_DESHY Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfitobacterium hafniense (strain Y51) GN=gcvPA PE=3 SV=1 178 484 9.0E-56
sp|C5A7J1|GCSPA_THEGJ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gcvPA PE=3 SV=1 106 476 1.0E-55
sp|B8FT31|GCSPA_DESHD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=gcvPA PE=3 SV=1 178 484 2.0E-55
sp|Q9WY56|GCSPA_THEMA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gcvPA PE=3 SV=1 105 486 3.0E-55
sp|Q8TZJ3|GCSPA_PYRFU Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gcvPA PE=3 SV=1 106 476 6.0E-55
sp|A1BE03|GCSPA_CHLPD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gcvPA PE=3 SV=1 113 451 7.0E-55
sp|B5YFB8|GCSPA_DICT6 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gcvPA PE=3 SV=1 174 486 1.0E-54
sp|B4SE02|GCSPA_PELPB Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gcvPA PE=3 SV=1 117 474 1.0E-54
sp|A5IKK8|GCSPA_THEP1 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gcvPA PE=3 SV=1 178 486 3.0E-54
sp|B1L9T9|GCSPA_THESQ Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermotoga sp. (strain RQ2) GN=gcvPA PE=3 SV=1 105 485 6.0E-54
sp|B9KZ42|GCSPA_THERP Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=gcvPA PE=3 SV=1 113 464 1.0E-53
sp|B5EAW7|GCSPA_GEOBB Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gcvPA PE=3 SV=1 110 472 1.0E-53
sp|B8E2E7|GCSPA_DICTD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=gcvPA PE=3 SV=1 155 475 4.0E-53
sp|B3EH28|GCSPA_CHLL2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gcvPA PE=3 SV=1 113 464 5.0E-53
sp|C6DYX1|GCSPA_GEOSM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Geobacter sp. (strain M21) GN=gcvPA PE=3 SV=1 110 472 6.0E-52
sp|Q0BYP2|GCSPA_HYPNA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=gcvPA PE=3 SV=1 106 477 7.0E-52
sp|Q3B2G3|GCSPA_CHLL7 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gcvPA PE=3 SV=1 156 474 9.0E-52
sp|Q02BS4|GCSPA_SOLUE Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Solibacter usitatus (strain Ellin6076) GN=gcvPA PE=3 SV=1 106 474 2.0E-51
sp|A4SG06|GCSPA_CHLPM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gcvPA PE=3 SV=1 114 474 5.0E-51
sp|Q9HII1|GCSPA_THEAC Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gcvPA PE=3 SV=1 178 532 6.0E-51
sp|A9FQM4|GCSPA_SORC5 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Sorangium cellulosum (strain So ce56) GN=gcvPA PE=3 SV=1 106 550 2.0E-50
sp|Q2YCK1|GCSPA_NITMU Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gcvPA PE=3 SV=1 112 467 3.0E-50
sp|Q0AMJ2|GCSPA_MARMM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Maricaulis maris (strain MCS10) GN=gcvPA PE=3 SV=1 106 464 3.0E-50
sp|B4RF16|GCSPA_PHEZH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Phenylobacterium zucineum (strain HLK1) GN=gcvPA PE=3 SV=1 175 510 4.0E-50
sp|A5V9T6|GCSPA_SPHWW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gcvPA PE=3 SV=1 106 477 1.0E-49
sp|A0L7X6|GCSPA_MAGMM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gcvPA PE=3 SV=1 110 486 1.0E-49
sp|Q0AEP9|GCSPA_NITEC Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Nitrosomonas eutropha (strain C91) GN=gcvPA PE=3 SV=1 112 467 2.0E-49
sp|A8HT29|GCSPA_AZOC5 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gcvPA PE=3 SV=1 106 485 2.0E-49
sp|Q82WQ4|GCSPA_NITEU Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gcvPA PE=3 SV=1 112 474 3.0E-49
sp|Q97C05|GCSPA_THEVO Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gcvPA PE=3 SV=1 178 530 4.0E-49
sp|B9M3X6|GCSPA_GEODF Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gcvPA PE=3 SV=1 113 478 6.0E-49
sp|B3QM32|GCSPA_CHLP8 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobaculum parvum (strain NCIB 8327) GN=gcvPA PE=3 SV=1 114 474 1.0E-48
sp|Q311A7|GCSPA_DESAG Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfovibrio alaskensis (strain G20) GN=gcvPA PE=3 SV=1 113 471 1.0E-48
sp|B6IXI3|GCSPA_RHOCS Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gcvPA PE=3 SV=1 178 477 1.0E-48
sp|Q9YA15|GCSPA_AERPE Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gcvPA PE=3 SV=2 117 467 1.0E-48
sp|Q8KC05|GCSPA_CHLTE Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gcvPA PE=3 SV=1 114 474 3.0E-48
sp|Q3SMB8|GCSPA_THIDA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gcvPA PE=3 SV=1 112 477 4.0E-48
sp|B0TZJ6|GCSPA_FRAP2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gcvPA PE=3 SV=1 159 479 4.0E-48
sp|Q2W9A3|GCSPA_MAGSA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gcvPA PE=3 SV=1 106 485 5.0E-48
sp|Q0AVH8|GCSPA_SYNWW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gcvPA PE=3 SV=1 145 485 6.0E-48
sp|Q6MEJ2|GCSPA_PARUW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Protochlamydia amoebophila (strain UWE25) GN=gcvPA PE=3 SV=1 178 475 6.0E-48
sp|A7IHE9|GCSPA_XANP2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gcvPA PE=3 SV=1 106 445 1.0E-47
sp|B1GYV7|GCSPA_UNCTG Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gcvPA PE=3 SV=1 112 472 1.0E-47
sp|B8EPH9|GCSPA_METSB Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gcvPA PE=3 SV=1 106 490 2.0E-47
sp|B2IGK3|GCSPA_BEII9 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gcvPA PE=3 SV=1 106 490 2.0E-47
sp|A1WWA5|GCSPA_HALHL Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gcvPA PE=3 SV=1 110 484 2.0E-47
sp|B5Y9D4|GCSPA_COPPD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gcvPA PE=3 SV=1 174 451 4.0E-47
sp|Q60BW4|GCSPA_METCA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gcvPA PE=3 SV=1 110 463 6.0E-47
sp|Q2N886|GCSPA_ERYLH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=gcvPA PE=3 SV=1 106 471 8.0E-47
sp|A3DNJ9|GCSPA_STAMF Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=gcvPA PE=3 SV=1 178 464 9.0E-47
sp|A7NAH8|GCSPA_FRATF Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|Q6ARJ7|GCSPA_DESPS Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gcvPA PE=3 SV=1 106 464 2.0E-46
sp|C6C0V0|GCSPA_DESAD Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=gcvPA PE=3 SV=1 113 510 2.0E-46
sp|B2SFM3|GCSPA_FRATM Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|A4IZK6|GCSPA_FRATW Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|Q5NHN8|GCSPA_FRATT Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|Q14J40|GCSPA_FRAT1 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|Q0BN71|GCSPA_FRATO Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|Q2A4V1|GCSPA_FRATH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gcvPA PE=3 SV=1 159 470 2.0E-46
sp|C3N5G1|GCSPA_SULIA Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Sulfolobus islandicus (strain M.16.27) GN=gcvPA PE=3 SV=1 117 464 3.0E-46
sp|A7HQY0|GCSPA_PARL1 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gcvPA PE=3 SV=1 106 490 3.0E-46
sp|Q1GRZ2|GCSPA_SPHAL Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gcvPA PE=3 SV=1 106 479 4.0E-46
sp|A0Q587|GCSPA_FRATN Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=gcvPA PE=3 SV=1 159 470 5.0E-46
sp|Q9YA15|GCSPA_AERPE Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gcvPA PE=3 SV=2 721 996 4.0E-09
sp|A9FQM4|GCSPA_SORC5 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Sorangium cellulosum (strain So ce56) GN=gcvPA PE=3 SV=1 580 993 4.0E-08
sp|A8FF40|GCSPA_BACP2 Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Bacillus pumilus (strain SAFR-032) GN=gcvPA PE=3 SV=1 579 865 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004375 glycine dehydrogenase (decarboxylating) activity Yes
GO:0006546 glycine catabolic process Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0016642 oxidoreductase activity, acting on the CH-NH2 group of donors, disulfide as acceptor No
GO:0044248 cellular catabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0009056 catabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006544 glycine metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0044282 small molecule catabolic process No
GO:0008152 metabolic process No
GO:1901606 alpha-amino acid catabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0009071 serine family amino acid catabolic process No
GO:0044238 primary metabolic process No
GO:0009063 cellular amino acid catabolic process No
GO:0009069 serine family amino acid metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006082 organic acid metabolic process No
GO:0003674 molecular_function No
GO:0006520 cellular amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016054 organic acid catabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2629
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6466
Ophiocordyceps australis map64 (Brazil) OphauB2|847
Ophiocordyceps camponoti-floridani Ophcf2|02652
Ophiocordyceps camponoti-rufipedis Ophun1|5879 (this protein)
Ophiocordyceps kimflemingae Ophio5|3611
Ophiocordyceps subramaniannii Hirsu2|4015

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5879
MALIRASICRFGRAPIISRAVRFYTTSPESAEPTGTNDKLPGPIPYDIPDTSDIKWFRNKFGGSGPDGKITDGLF
YEQHDSRKTENGARMRNAPLMQRHKKVFGYRHIGPRQEDEAEMLKALGPGAETLNSFVKQVIPEDVMLPPDKTIV
GRQLSEEGVKREFERMQLANDRKIWMNGGGYYSVEVPPVIKRNLLENPGWYTSYTPYQAEISQGRLESLLNFQTM
VSDLTGLPVANASLLDEGTAAAEAMTLSYGNLPSARAKRGDKVFLVSKEIHKTTKWVMRGRAEGFGIRLMSVDLS
SPEIDQTIKRVGKGLVGVLAQYPDTFGGVQDFRHLAHLVHEQGALFSVATDLSALTFLTPPGEFGADIAVGNSQH
FGVPLGFGGPHAAFMAVADSIKRRLPGRLVGVSKDRTGGRALRLALQTREQHIRREKATSNVCTSQALLANMAAM
YAIYHGPKQLRTMAIASLRHARMIQKAAEHYGLEVCTRTIDPEGRVLSDTVAISDSLDRLGKLQLALAKTHISAG
ESFTCRELMLAVPANFNDTNFTRIVQCFRTMAKRNEMDDAADLAADIWCKGYEESEERIIEGLPAAVRRTSSFLT
HPVFNSYHSETELMRYIHHLQSKDLSLIHSMIPLGSCTMKLNAAFQMDLITSSHVSSSHPNAPMAFVKGWRQLVL
VLNMQLNSLTGMHSTSLQPNSGAQGEFAGLRVIRKYHEENDPEQVRDICLIPVSAHGTNPASATMAGMKVVTVRC
DPRTGNLDLADLEAKCKLHQDHLGAIMVTYPSTYGVFEPDIRKVCDMVHEYGGQVYMDGANMNAQIGLTSPGALG
ADVCHLNLHKTFCIPHGGGGPGVGPICVKEHLNKFLPHKLGRPRVSSALYGSASILPISWAYLSAMGDDSLVRAT
KIALLNANYMLARLKEHYLILYTNDKGRCAHEFIIDARHFKATSGIEAIDIAKRLQDYGFHAPTMSWPVPNTLMI
EPTESESKAELDRFVDAMISIRKEIAEIESGRQPRAGNVLKMAPHTQADIIDGDGDGSWNRPYSRQQAAYPLPWL
REKKFWPSVTRVDDAHGDTNLFCTCPPIEDGTNEANMSDQVTAKTEPEPEPETTPTKADELQAAVDKVEAEAMES
LPATSEPSKDGADGNVKKP*
Coding >Ophun1|5879
ATGGCTCTCATCCGGGCCTCCATATGTCGCTTCGGCCGTGCTCCGATCATCAGCCGAGCTGTCCGTTTCTACACG
ACCAGCCCAGAGTCGGCCGAGCCCACGGGAACCAACGACAAGCTGCCGGGACCCATCCCTTACGATATTCCGGAT
ACGTCTGATATCAAGTGGTTCCGTAACAAATTCGGCGGGAGCGGCCCAGACGGAAAGATCACAGATGGCTTGTTT
TACGAACAACATGATTCCAGAAAAACCGAAAATGGCGCCCGGATGAGGAATGCTCCTTTGATGCAAAGACATAAG
AAGGTATTCGGCTACCGTCACATTGGTCCTCGCCAGGAGGACGAGGCCGAGATGCTCAAGGCCCTGGGACCGGGT
GCCGAGACGCTCAATTCCTTCGTTAAGCAGGTCATCCCGGAAGATGTCATGCTCCCACCCGACAAGACCATCGTT
GGCCGTCAGTTATCAGAGGAAGGCGTCAAGAGAGAATTCGAGCGCATGCAGTTGGCCAACGATAGAAAGATTTGG
ATGAACGGCGGAGGCTACTACTCGGTCGAGGTCCCTCCCGTCATCAAGAGAAATCTGCTGGAGAACCCGGGCTGG
TATACGAGCTACACGCCCTACCAGGCCGAGATCAGCCAAGGCCGCTTGGAATCGCTGCTCAACTTTCAGACCATG
GTCTCGGATCTCACTGGTCTCCCCGTTGCCAACGCCAGCCTGCTGGACGAGGGCACCGCCGCCGCCGAGGCCATG
ACATTGTCCTACGGCAATCTGCCCTCCGCCCGGGCCAAGCGCGGCGACAAGGTCTTCCTCGTCTCCAAGGAAATC
CACAAGACGACCAAGTGGGTGATGCGAGGCCGTGCCGAGGGCTTCGGTATCCGGCTCATGTCGGTTGACCTGTCA
TCGCCTGAAATCGACCAGACCATCAAAAGAGTAGGAAAGGGGCTGGTCGGCGTCCTGGCTCAGTATCCAGACACA
TTTGGTGGTGTGCAAGATTTCCGTCATCTGGCACACCTCGTCCACGAGCAAGGTGCTCTGTTCAGCGTCGCCACC
GATCTATCGGCTCTGACGTTCCTGACGCCTCCCGGCGAATTCGGGGCTGACATCGCCGTCGGCAACTCACAGCAC
TTTGGCGTGCCGCTGGGCTTCGGGGGCCCCCACGCCGCCTTCATGGCCGTGGCCGATTCGATCAAGCGCCGGCTG
CCCGGACGGCTCGTCGGCGTCTCCAAGGACCGCACCGGCGGCCGCGCCCTCCGGCTGGCGCTGCAGACGAGAGAG
CAGCACATTCGGCGAGAGAAGGCGACGAGCAACGTGTGTACGTCCCAGGCCCTGCTGGCCAACATGGCGGCCATG
TACGCCATCTACCACGGGCCGAAGCAGCTGAGGACCATGGCCATCGCCAGCCTGCGCCACGCCCGTATGATACAG
AAGGCGGCTGAACATTACGGACTCGAAGTGTGCACGCGTACCATCGACCCCGAGGGCCGGGTCCTCTCCGACACC
GTCGCCATTAGTGACTCGCTAGATCGCCTCGGAAAACTGCAGCTTGCCCTGGCCAAGACTCACATCAGTGCCGGC
GAGTCCTTCACCTGCCGAGAGCTGATGCTCGCTGTTCCAGCCAACTTTAACGACACCAACTTCACACGCATCGTT
CAGTGCTTCCGGACCATGGCCAAGAGGAACGAAATGGACGACGCGGCTGATCTTGCGGCTGACATCTGGTGCAAG
GGCTACGAGGAGTCGGAAGAGCGCATCATAGAGGGTCTGCCCGCTGCCGTCAGACGAACGTCGTCCTTCCTGACA
CACCCCGTCTTCAACTCGTACCATAGCGAGACGGAGCTCATGCGCTACATACACCACCTGCAGTCCAAGGACCTC
TCCTTGATCCATTCCATGATTCCCCTGGGATCGTGCACCATGAAGCTCAACGCCGCCTTTCAGATGGACCTCATC
ACCAGCTCCCACGTCTCCAGCTCGCATCCCAACGCCCCAATGGCCTTTGTCAAGGGATGGAGGCAGCTCGTCCTG
GTGCTCAACATGCAGCTCAACAGCCTGACTGGCATGCATTCGACGTCACTACAGCCCAACTCGGGTGCGCAGGGC
GAGTTTGCCGGGCTGCGTGTCATCCGGAAATACCACGAGGAGAATGATCCGGAGCAAGTTCGAGATATCTGCCTG
ATCCCCGTCTCGGCTCACGGGACGAACCCGGCCTCGGCCACCATGGCGGGAATGAAAGTCGTCACCGTCAGGTGT
GACCCTCGCACCGGTAACCTCGACCTGGCCGACCTCGAGGCCAAGTGCAAGCTGCACCAGGATCACCTGGGGGCC
ATCATGGTGACGTATCCCAGCACCTATGGCGTCTTCGAGCCCGACATCCGCAAGGTCTGCGACATGGTCCACGAG
TACGGCGGTCAGGTCTACATGGACGGCGCCAACATGAACGCCCAGATCGGCCTCACGTCCCCGGGGGCTCTGGGG
GCCGACGTCTGTCACCTCAACCTGCACAAGACGTTCTGCATCCCCCACGGCGGCGGCGGGCCGGGAGTCGGTCCC
ATTTGCGTCAAGGAGCACCTCAACAAGTTTCTCCCGCACAAGCTGGGCCGGCCACGGGTATCGAGTGCCCTCTAT
GGCAGCGCCAGCATCTTGCCCATCAGCTGGGCCTATCTTTCCGCCATGGGGGACGATTCTCTCGTCCGCGCTACA
AAGATTGCCCTCCTCAACGCAAACTACATGCTGGCCCGGCTCAAGGAACATTACCTCATCCTGTACACCAACGAC
AAGGGCCGTTGCGCGCACGAGTTCATCATCGATGCCCGGCACTTCAAGGCGACCAGCGGCATCGAAGCCATCGAC
ATCGCCAAGCGGCTACAGGACTACGGCTTCCACGCGCCGACGATGAGCTGGCCCGTTCCCAACACGCTGATGATC
GAGCCGACGGAGAGCGAGAGCAAGGCGGAGCTGGACCGCTTCGTCGACGCCATGATCAGCATCCGCAAGGAGATT
GCCGAAATCGAGAGCGGCAGACAGCCTCGCGCGGGCAACGTCCTCAAGATGGCGCCTCACACGCAGGCTGACATC
ATCGACGGCGACGGCGACGGCAGCTGGAATCGTCCGTACTCGCGACAGCAGGCTGCCTACCCGCTGCCATGGCTG
CGGGAGAAGAAGTTTTGGCCGTCGGTGACGCGCGTGGATGATGCGCATGGCGATACTAATCTCTTCTGCACCTGT
CCCCCGATCGAGGACGGAACGAACGAGGCAAACATGTCGGACCAAGTCACCGCCAAGACCGAGCCCGAGCCCGAG
CCCGAAACGACACCGACAAAGGCCGACGAACTGCAAGCAGCCGTGGACAAGGTCGAGGCCGAGGCCATGGAGAGT
CTCCCCGCTACCTCAGAGCCGTCGAAAGATGGTGCGGACGGGAATGTCAAGAAGCCATGA
Transcript >Ophun1|5879
ATGGCTCTCATCCGGGCCTCCATATGTCGCTTCGGCCGTGCTCCGATCATCAGCCGAGCTGTCCGTTTCTACACG
ACCAGCCCAGAGTCGGCCGAGCCCACGGGAACCAACGACAAGCTGCCGGGACCCATCCCTTACGATATTCCGGAT
ACGTCTGATATCAAGTGGTTCCGTAACAAATTCGGCGGGAGCGGCCCAGACGGAAAGATCACAGATGGCTTGTTT
TACGAACAACATGATTCCAGAAAAACCGAAAATGGCGCCCGGATGAGGAATGCTCCTTTGATGCAAAGACATAAG
AAGGTATTCGGCTACCGTCACATTGGTCCTCGCCAGGAGGACGAGGCCGAGATGCTCAAGGCCCTGGGACCGGGT
GCCGAGACGCTCAATTCCTTCGTTAAGCAGGTCATCCCGGAAGATGTCATGCTCCCACCCGACAAGACCATCGTT
GGCCGTCAGTTATCAGAGGAAGGCGTCAAGAGAGAATTCGAGCGCATGCAGTTGGCCAACGATAGAAAGATTTGG
ATGAACGGCGGAGGCTACTACTCGGTCGAGGTCCCTCCCGTCATCAAGAGAAATCTGCTGGAGAACCCGGGCTGG
TATACGAGCTACACGCCCTACCAGGCCGAGATCAGCCAAGGCCGCTTGGAATCGCTGCTCAACTTTCAGACCATG
GTCTCGGATCTCACTGGTCTCCCCGTTGCCAACGCCAGCCTGCTGGACGAGGGCACCGCCGCCGCCGAGGCCATG
ACATTGTCCTACGGCAATCTGCCCTCCGCCCGGGCCAAGCGCGGCGACAAGGTCTTCCTCGTCTCCAAGGAAATC
CACAAGACGACCAAGTGGGTGATGCGAGGCCGTGCCGAGGGCTTCGGTATCCGGCTCATGTCGGTTGACCTGTCA
TCGCCTGAAATCGACCAGACCATCAAAAGAGTAGGAAAGGGGCTGGTCGGCGTCCTGGCTCAGTATCCAGACACA
TTTGGTGGTGTGCAAGATTTCCGTCATCTGGCACACCTCGTCCACGAGCAAGGTGCTCTGTTCAGCGTCGCCACC
GATCTATCGGCTCTGACGTTCCTGACGCCTCCCGGCGAATTCGGGGCTGACATCGCCGTCGGCAACTCACAGCAC
TTTGGCGTGCCGCTGGGCTTCGGGGGCCCCCACGCCGCCTTCATGGCCGTGGCCGATTCGATCAAGCGCCGGCTG
CCCGGACGGCTCGTCGGCGTCTCCAAGGACCGCACCGGCGGCCGCGCCCTCCGGCTGGCGCTGCAGACGAGAGAG
CAGCACATTCGGCGAGAGAAGGCGACGAGCAACGTGTGTACGTCCCAGGCCCTGCTGGCCAACATGGCGGCCATG
TACGCCATCTACCACGGGCCGAAGCAGCTGAGGACCATGGCCATCGCCAGCCTGCGCCACGCCCGTATGATACAG
AAGGCGGCTGAACATTACGGACTCGAAGTGTGCACGCGTACCATCGACCCCGAGGGCCGGGTCCTCTCCGACACC
GTCGCCATTAGTGACTCGCTAGATCGCCTCGGAAAACTGCAGCTTGCCCTGGCCAAGACTCACATCAGTGCCGGC
GAGTCCTTCACCTGCCGAGAGCTGATGCTCGCTGTTCCAGCCAACTTTAACGACACCAACTTCACACGCATCGTT
CAGTGCTTCCGGACCATGGCCAAGAGGAACGAAATGGACGACGCGGCTGATCTTGCGGCTGACATCTGGTGCAAG
GGCTACGAGGAGTCGGAAGAGCGCATCATAGAGGGTCTGCCCGCTGCCGTCAGACGAACGTCGTCCTTCCTGACA
CACCCCGTCTTCAACTCGTACCATAGCGAGACGGAGCTCATGCGCTACATACACCACCTGCAGTCCAAGGACCTC
TCCTTGATCCATTCCATGATTCCCCTGGGATCGTGCACCATGAAGCTCAACGCCGCCTTTCAGATGGACCTCATC
ACCAGCTCCCACGTCTCCAGCTCGCATCCCAACGCCCCAATGGCCTTTGTCAAGGGATGGAGGCAGCTCGTCCTG
GTGCTCAACATGCAGCTCAACAGCCTGACTGGCATGCATTCGACGTCACTACAGCCCAACTCGGGTGCGCAGGGC
GAGTTTGCCGGGCTGCGTGTCATCCGGAAATACCACGAGGAGAATGATCCGGAGCAAGTTCGAGATATCTGCCTG
ATCCCCGTCTCGGCTCACGGGACGAACCCGGCCTCGGCCACCATGGCGGGAATGAAAGTCGTCACCGTCAGGTGT
GACCCTCGCACCGGTAACCTCGACCTGGCCGACCTCGAGGCCAAGTGCAAGCTGCACCAGGATCACCTGGGGGCC
ATCATGGTGACGTATCCCAGCACCTATGGCGTCTTCGAGCCCGACATCCGCAAGGTCTGCGACATGGTCCACGAG
TACGGCGGTCAGGTCTACATGGACGGCGCCAACATGAACGCCCAGATCGGCCTCACGTCCCCGGGGGCTCTGGGG
GCCGACGTCTGTCACCTCAACCTGCACAAGACGTTCTGCATCCCCCACGGCGGCGGCGGGCCGGGAGTCGGTCCC
ATTTGCGTCAAGGAGCACCTCAACAAGTTTCTCCCGCACAAGCTGGGCCGGCCACGGGTATCGAGTGCCCTCTAT
GGCAGCGCCAGCATCTTGCCCATCAGCTGGGCCTATCTTTCCGCCATGGGGGACGATTCTCTCGTCCGCGCTACA
AAGATTGCCCTCCTCAACGCAAACTACATGCTGGCCCGGCTCAAGGAACATTACCTCATCCTGTACACCAACGAC
AAGGGCCGTTGCGCGCACGAGTTCATCATCGATGCCCGGCACTTCAAGGCGACCAGCGGCATCGAAGCCATCGAC
ATCGCCAAGCGGCTACAGGACTACGGCTTCCACGCGCCGACGATGAGCTGGCCCGTTCCCAACACGCTGATGATC
GAGCCGACGGAGAGCGAGAGCAAGGCGGAGCTGGACCGCTTCGTCGACGCCATGATCAGCATCCGCAAGGAGATT
GCCGAAATCGAGAGCGGCAGACAGCCTCGCGCGGGCAACGTCCTCAAGATGGCGCCTCACACGCAGGCTGACATC
ATCGACGGCGACGGCGACGGCAGCTGGAATCGTCCGTACTCGCGACAGCAGGCTGCCTACCCGCTGCCATGGCTG
CGGGAGAAGAAGTTTTGGCCGTCGGTGACGCGCGTGGATGATGCGCATGGCGATACTAATCTCTTCTGCACCTGT
CCCCCGATCGAGGACGGAACGAACGAGGCAAACATGTCGGACCAAGTCACCGCCAAGACCGAGCCCGAGCCCGAG
CCCGAAACGACACCGACAAAGGCCGACGAACTGCAAGCAGCCGTGGACAAGGTCGAGGCCGAGGCCATGGAGAGT
CTCCCCGCTACCTCAGAGCCGTCGAAAGATGGTGCGGACGGGAATGTCAAGAAGCCATGA
Gene >Ophun1|5879
ATGGCTCTCATCCGGGCCTCCATATGTCGCTTCGGCCGTGCTCCGATCATCAGCCGAGCTGTCCGTTTCTACACG
ACCAGCCCAGAGTCGGCCGAGCCCACGGGAACCAACGACAAGCTGCCGGGACCCATCCCTTACGATATTCCGGAT
ACGTCTGATATCAAGTGGTTCCGTAACAAATTCGGCGGGAGCGGCCCAGACGGAAAGATCACAGATGGCTTGTTT
TACGAACAACATGATTCCAGAAAAACCGAAAATGGCGCCCGGATGAGGAATGCTCCTTTGATGCAAAGACATAAG
AAGGTATTCGGCTACCGTCACATTGGTCCTCGCCAGGAGGACGAGGCCGAGATGCTCAAGGCCCTGGGACCGGGT
GCCGAGACGCTCAATTCCTTCGTTAAGCAGGTCATCCCGGAAGATGTCATGCTCCCACCCGACAAGACCATCGTT
GGCCGTCAGTTATCAGAGGAAGGCGTCAAGAGAGAATTCGAGCGCATGCAGTTGGCCAACGATAGAAAGATTTGG
ATGAACGGCGGAGGCTACTACTCGGTCGAGGTCCCTCCCGTCATCAAGAGAAATCTGCTGGAGAACCCGGGCTGG
TATACGAGCTACACGCCCTACCAGGCCGAGATCAGCCAAGGCCGCTTGGAATCGCTGCTCAACTTTCAGACCATG
GTCTCGGATCTCACTGGTCTCCCCGTTGCCAACGCCAGCCTGCTGGACGAGGGCACCGCCGCCGCCGAGGCCATG
ACATTGTCCTACGGCAATCTGCCCTCCGCCCGGGCCAAGCGCGGCGACAAGGTCTTCCTCGTCTCCAAGGAAATC
CACAAGACGACCAAGTGGGTGATGCGAGGCCGTGCCGAGGGCTTCGGTATCCGGCTCATGTCGGTTGACCTGTCA
TCGCCTGAAATCGACCAGACCATCAAAAGAGTAGGAAAGGGGCTGGTCGGCGTCCTGGCTCAGTATCCAGACACA
TTTGGTGGTGTGCAAGATTTCCGTCATCTGGCACACCTCGTCCACGAGCAAGGTGCTCTGTTCAGCGTCGCCACC
GATCTATCGGCTCTGACGTTCCTGACGCCTCCCGGCGAATTCGGGGCTGACATCGCCGTCGGCAACTCACAGCAC
TTTGGCGTGCCGCTGGGCTTCGGGGGCCCCCACGCCGCCTTCATGGCCGTGGCCGATTCGATCAAGCGCCGGCTG
CCCGGACGGCTCGTCGGCGTCTCCAAGGACCGCACCGGCGGCCGCGCCCTCCGGCTGGCGCTGCAGACGAGAGAG
CAGCACATTCGGCGAGAGAAGGCGACGAGCAACGTGTGTACGTCCCAGGCCCTGCTGGCCAACATGGCGGCCATG
TACGCCATCTACCACGGGCCGAAGCAGCTGAGGACCATGGCCATCGCCAGCCTGCGCCACGCCCGTATGATACAG
AAGGCGGCTGAACATTACGGACTCGAAGTGTGCACGCGTACCATCGACCCCGAGGGCCGGGTCCTCTCCGACACC
GTCGCCATTAGTGACTCGCTAGATCGCCTCGGAAAACTGCAGCTTGCCCTGGCCAAGACTCACATCAGTGCCGGC
GAGTCCTTCACCTGCCGAGAGCTGATGCTCGCTGTTCCAGCCAACTTTAACGACACCAACTTCACACGCATCGTT
CAGTGCTTCCGGACCATGGCCAAGAGGAACGAAATGGACGACGCGGCTGATCTTGCGGCTGACATCTGGTGCAAG
GGCTACGAGGAGTCGGAAGAGCGCATCATAGAGGGTCTGCCCGCTGCCGTCAGACGAACGTCGTCCTTCCTGACA
CACCCCGTCTTCAACTCGTACCATAGCGAGACGGAGCTCATGCGCTACATACACCACCTGCAGTCCAAGGACCTC
TCCTTGATCCATTCCATGATTCCCCTGGGATCGTGCACCATGAAGCTCAACGCCGCCTTTCAGATGGACCTCATC
ACCAGCTCCCACGTCTCCAGCTCGCATCCCAACGCCCCAATGGCCTTTGTCAAGGGATGGAGGCAGCTCGTCCTG
GTGCTCAACATGCAGCTCAACAGCCTGACTGGCATGCATTCGACGTCACTACAGCCCAACTCGGGTGCGCAGGGC
GAGTTTGCCGGGCTGCGTGTCATCCGGAAATACCACGAGGAGAATGATCCGGAGCAAGTTCGAGATATCTGCCTG
ATCCCCGTCTCGGCTCACGGGACGAACCCGGCCTCGGCCACCATGGCGGGAATGAAAGTCGTCACCGTCAGGTGT
GACCCTCGCACCGGTAACCTCGACCTGGCCGACCTCGAGGCCAAGTGCAAGCTGCACCAGGATCACCTGGGGGCC
ATCATGGTGACGTATCCCAGCACCTATGGCGTCTTCGAGCCCGACATCCGCAAGGTCTGCGACATGGTCCACGAG
TACGGCGGTCAGGTCTACATGGACGGCGCCAACATGAACGCCCAGATCGGCCTCACGTCCCCGGGGGCTCTGGGG
GCCGACGTCTGTCACCTCAACCTGCACAAGACGTTCTGCATCCCCCACGGCGGCGGCGGGCCGGGAGTCGGTCCC
ATTTGCGTCAAGGAGCACCTCAACAAGTTTCTCCCGCACAAGCTGGGCCGGCCACGGGTATCGAGTGCCCTCTAT
GGCAGCGCCAGCATCTTGCCCATCAGCTGGGCCTATCTTTCCGCCATGGGTGAGTCTTGGTCTTGTTCTTCTTAG
CCTCGCTCGTCTCGGTGGACCAGGTTGCTAACACAGCCAACTTAAGGGGACGATTCTCTCGTCCGCGCTACAAAG
ATTGCCCTCCTCAACGCAAACTACATGCTGGCCCGGCTCAAGGAACATTACCTCATCCTGTACACCAACGACAAG
GGCCGTTGCGCGCACGAGTTCATCATCGATGCCCGGCACTTCAAGGCGACCAGCGGCATCGAAGCCATCGACATC
GCCAAGCGGCTACAGGACTACGGCTTCCACGCGCCGACGATGAGCTGGCCCGTTCCCAACACGCTGATGATCGAG
CCGACGGAGAGCGAGAGCAAGGCGGAGCTGGACCGCTTCGTCGACGCCATGATCAGCATCCGCAAGGAGATTGCC
GAAATCGAGAGCGGCAGACAGCCTCGCGCGGGCAACGTCCTCAAGATGGCGCCTCACACGCAGGCTGACATCATC
GACGGCGACGGCGACGGCAGCTGGAATCGTCCGTACTCGCGACAGCAGGCTGCCTACCCGCTGCCATGGCTGCGG
GAGAAGAAGTTTTGGCCGTCGGTGACGCGCGTGGATGATGGTGCGTCTTGAACAAGGATCCGTGGGAAGAAGTTG
CTCTGACTTGGTGGCAGCGCATGGCGATACTAATCTCTTCTGCACCTGTCCCCCGATCGAGGACGGAACGAACGA
GGCAAACATGTCGGACCAAGTCACCGCCAAGACCGAGCCCGAGCCCGAGCCCGAAACGACACCGACAAAGGCCGA
CGAACTGCAAGCAGCCGTGGACAAGGTCGAGGCCGAGGCCATGGAGAGTCTCCCCGCTACCTCAGAGCCGTCGAA
AGATGGTGCGGACGGGAATGTCAAGAAGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail