Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5877
Gene name
LocationContig_602:10334..11332
Strand-
Gene length (bp)998
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 54 220 2.0E-06
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 10 266 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 65 87 22
3 102 124 22
4 131 153 22
5 163 185 22
6 206 228 22
7 269 288 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5877
MAALSFTSGFQEADSRFAWNSAYVITLLIVSLLLWLILLAWERHITLFSQVREPVIPWRFFTDRVRAGVMLVFVL
VGVPIVVTNFQLPQRFQLVNGLSSIDASVRILPFGAAFCVGSLASSRLTSSLRVPSIYHVLAGSAMQVVGFALLG
VLPSSPDIQPAVYGYQVLCGIGVGLNYMALYLLIPFTADRRDRAIGMGLAGQFRTMGSAFGLAIVTSVFNGYTGP
RLASLGLSAEVTSVEGLGTQRLSTITPEILADVRNILSEAYNRQMLVLCAFAAAQMPAALLIWKRKQLVAA*
Coding >Ophun1|5877
ATGGCCGCGCTTTCTTTCACTTCCGGCTTTCAGGAGGCCGATTCACGGTTTGCGTGGAACTCGGCCTACGTCATC
ACGCTTCTCATCGTCTCCCTCCTCCTTTGGCTTATTCTGCTGGCTTGGGAGCGCCACATTACCTTGTTTAGCCAA
GTTCGCGAGCCCGTCATACCCTGGCGTTTCTTTACCGACCGCGTCAGGGCTGGCGTCATGCTCGTCTTCGTTCTC
GTGGGCGTGCCCATTGTCGTCACAAACTTTCAGCTGCCGCAGAGGTTTCAGCTTGTCAACGGTCTCTCGAGCATT
GACGCGAGCGTCCGGATTCTGCCATTCGGCGCGGCCTTTTGTGTGGGTTCCCTGGCCAGCTCGCGGCTCACCAGC
AGTTTGAGAGTGCCCAGTATCTACCACGTACTCGCCGGATCTGCCATGCAGGTCGTCGGCTTTGCGCTGCTTGGC
GTCTTGCCGTCTTCGCCGGATATCCAACCAGCCGTGTATGGTTATCAGGTGCTGTGCGGCATCGGTGTTGGTCTC
AACTACATGGCTCTGTATCTCCTGATTCCCTTTACCGCGGACCGAAGAGACAGGGCCATTGGCATGGGCCTCGCC
GGACAGTTCCGCACCATGGGGAGCGCCTTTGGACTGGCAATTGTCACTTCCGTCTTCAACGGCTACACAGGGCCT
CGATTGGCAAGCCTGGGCCTCTCGGCTGAAGTCACCAGCGTCGAAGGTCTGGGGACGCAGCGACTGTCGACGATC
ACGCCCGAGATCTTGGCCGACGTGCGAAACATTCTATCAGAGGCGTATAATCGGCAGATGCTGGTGCTGTGTGCT
TTTGCGGCCGCCCAGATGCCGGCCGCGCTGCTCATTTGGAAGCGGAAACAACTTGTGGCCGCATAG
Transcript >Ophun1|5877
ATGGCCGCGCTTTCTTTCACTTCCGGCTTTCAGGAGGCCGATTCACGGTTTGCGTGGAACTCGGCCTACGTCATC
ACGCTTCTCATCGTCTCCCTCCTCCTTTGGCTTATTCTGCTGGCTTGGGAGCGCCACATTACCTTGTTTAGCCAA
GTTCGCGAGCCCGTCATACCCTGGCGTTTCTTTACCGACCGCGTCAGGGCTGGCGTCATGCTCGTCTTCGTTCTC
GTGGGCGTGCCCATTGTCGTCACAAACTTTCAGCTGCCGCAGAGGTTTCAGCTTGTCAACGGTCTCTCGAGCATT
GACGCGAGCGTCCGGATTCTGCCATTCGGCGCGGCCTTTTGTGTGGGTTCCCTGGCCAGCTCGCGGCTCACCAGC
AGTTTGAGAGTGCCCAGTATCTACCACGTACTCGCCGGATCTGCCATGCAGGTCGTCGGCTTTGCGCTGCTTGGC
GTCTTGCCGTCTTCGCCGGATATCCAACCAGCCGTGTATGGTTATCAGGTGCTGTGCGGCATCGGTGTTGGTCTC
AACTACATGGCTCTGTATCTCCTGATTCCCTTTACCGCGGACCGAAGAGACAGGGCCATTGGCATGGGCCTCGCC
GGACAGTTCCGCACCATGGGGAGCGCCTTTGGACTGGCAATTGTCACTTCCGTCTTCAACGGCTACACAGGGCCT
CGATTGGCAAGCCTGGGCCTCTCGGCTGAAGTCACCAGCGTCGAAGGTCTGGGGACGCAGCGACTGTCGACGATC
ACGCCCGAGATCTTGGCCGACGTGCGAAACATTCTATCAGAGGCGTATAATCGGCAGATGCTGGTGCTGTGTGCT
TTTGCGGCCGCCCAGATGCCGGCCGCGCTGCTCATTTGGAAGCGGAAACAACTTGTGGCCGCATAG
Gene >Ophun1|5877
ATGGCCGCGCTTTCTTTCACTTCCGGCTTTCAGGAGGCCGATTCACGGTTTGCGTGGAACTCGGCCTACGTCATC
ACGCTTCTCATCGTCTCCCTCCTCCTTTGGCTTATTCTGCTGGCTTGGGAGCGCCACATTACCTTGTTTAGCCAA
GTTCGCGAGCCCGTCATACCCTGGCGTTTCTTTACCGACCGCGTCAGGGCTGGCGTCATGCTGTGGGCAGCCTGA
GATCCCCGCAAAGCTCAAGCGACTGACATGGCACTTCAGCGTCTTCGTTCTCGTGGGCGTGCCCATTGTCGTCAC
AAACTTTCAGCTGCCGCAGAGGTTTCAGCTTGTCAACGGTCTCTCGAGCATTGACGCGAGCGTCCGGATTCTGCC
ATTCGGCGCGGCCTTTTGTGTGGGTTCCCTGGCCAGCTCGCGGCTCACCAGCAGTTTGAGAGTGCCCAGTATCTA
CCACGTACTCGCCGGATCTGCCATGCAGGTCGTCGGCTTTGCGCTGCTTGGCGTCTTGCCGTCTTCGCCGGATAT
CCAACCAGCCGTGTATGGTTATCAGGTGCTGTGCGGCATCGGTGTTGGTCTCAACTACATGGCTCTGTATCTCCT
GATTCCCTTTACCGCGGACCGAAGAGACAGGGGTGAGTTACGGAGATATTCCCAATCGCAAAGAACGATGCAACT
GACGAAAGGCAGCCATTGGCATGGGCCTCGCCGGACAGTTCCGCACCATGGGGAGCGCCTTTGGACTGGCAATTG
TCACTTCCGTCTTCAACGGCTACACAGGGCCTCGATTGGCAAGCCTGGGCCTCTCGGCTGAAGTCACCAGCGTCG
AAGGTCTGGGGACGCAGCGACTGTCGACGATCACGCCCGAGATCTTGGCCGACGTGCGAAACATTCTATCAGAGG
CGTATAATCGGCAGATGCTGGTGCTGTGTGCTTTTGCGGCCGCCCAGATGCCGGCCGCGCTGCTCATTTGGAAGC
GGAAACAACTTGTGGCCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail