Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5863
Gene name
LocationContig_60:38157..40614
Strand-
Gene length (bp)2457
Transcript length (bp)2457
Coding sequence length (bp)2457
Protein length (aa) 819

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 6.3E-32 228 519
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 2.0E-20 536 767

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96RT8|GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1 519 752 7.0E-19
sp|Q95K09|GCP5_MACFA Gamma-tubulin complex component 5 (Fragment) OS=Macaca fascicularis GN=TUBGCP5 PE=2 SV=2 519 752 3.0E-18
sp|Q8BKN5|GCP5_MOUSE Gamma-tubulin complex component 5 OS=Mus musculus GN=Tubgcp5 PE=2 SV=2 518 752 5.0E-18

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6946
Ophiocordyceps australis map64 (Brazil) OphauB2|5845
Ophiocordyceps camponoti-floridani Ophcf2|04838
Ophiocordyceps camponoti-rufipedis Ophun1|5863 (this protein)
Ophiocordyceps kimflemingae Ophio5|7842
Ophiocordyceps subramaniannii Hirsu2|6630

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5863
MAFAARLGPLTEDLLQSLAPSDTEIDTQLPSSWLPDAVLRKLKTHPYLRTNPFEIEQRLEGLDEKFRVNNREALA
DALRLRLSSLSQQPSQWHPDVLHLLLELSDQPTFKSRLDSLDALQQSRELPPQEPPLKWEQIAREDGWGRDEDLW
KSTSYSSDGSVDDDTGLVSAVESSEATSLAGDDEAPARSAQDYIVHPVASDALQVVLEAQSWRAIPSEPCVVSEL
QVVRDVLFMLRGLDCSLFDCTGQPVPSFRMAGTASETHSALMGSLADKGRRMRIIRQFIAQPQTVPHVQALQDCL
SRRLAHFDGRLSAIESRFALPEGEVVVSLLAVTSELASCLEPALALSRIVSRLREATTSDTFYCLELLFDEIGVT
QLAGKSDTFEVLVRVFIECLNIYLRPVQLWMREGKLLPGDESFFVTEPSTRVSLGETWRSRFQIRKTADGRPQAP
SFIQPAVGDIYNAGRNMVVLRLLGKATTQLSSKAEPPLDYDALCPAGFELAPFADLFSAAFGRWVQSRCCETWAI
LKPTLVKDWGLFESLDALQALYLMADGRAAGTLCSALFAAKDTGWRDGYAVTMTGREAYALLRDPSRLVISFDED
LVRGNDSVRAVLPVIKVSYRVPWPVQMIVTTESMAHYQSIFTLLLQLKKAMHALHEARLPDDYDEDRPQSCLFYS
TRHKLLWFCATIHTYLATQVLEPTAVQMKRDLESANSIEAMIAAQCRAMKLMTEQACLGHELTSVREKMLDILDL
AVRLNHSQNSDCSEDLAETAVHLDQHARFVCRQLRSVASANSSLSSAKWHVLADMLQTGVRDDGRSLR*
Coding >Ophun1|5863
ATGGCCTTTGCAGCGCGTCTCGGTCCCCTGACTGAAGACCTGCTACAGAGCCTGGCCCCGTCAGATACAGAGATT
GACACCCAGCTGCCCTCCTCATGGCTCCCCGACGCGGTCCTACGCAAGCTCAAGACTCACCCTTACCTGCGAACC
AATCCCTTCGAGATTGAGCAACGCCTCGAAGGTCTCGACGAGAAATTCCGTGTCAATAATCGCGAAGCTTTGGCC
GATGCTCTGCGTCTACGTCTGAGCTCCTTGTCGCAGCAACCCTCGCAATGGCACCCCGATGTGCTACATCTACTC
CTCGAGCTATCCGACCAACCGACCTTTAAATCCCGTCTCGATAGCCTTGATGCTTTGCAGCAGTCTCGCGAGCTG
CCGCCACAGGAACCTCCCCTGAAATGGGAACAGATCGCCCGCGAGGATGGCTGGGGCCGAGACGAGGATCTCTGG
AAGTCGACCAGCTACAGCAGCGATGGCTCCGTGGACGACGACACCGGCCTCGTCTCCGCTGTCGAGTCTTCAGAA
GCTACCTCTCTCGCTGGAGACGACGAGGCACCTGCCCGATCAGCCCAAGACTACATCGTCCATCCCGTGGCCTCG
GACGCTCTACAAGTTGTCCTTGAGGCTCAGTCCTGGCGAGCTATTCCGTCTGAGCCCTGCGTCGTCTCGGAGCTT
CAGGTAGTGCGCGACGTTCTTTTCATGCTTCGCGGACTCGATTGCTCCCTATTCGACTGCACAGGCCAGCCCGTC
CCCAGCTTCCGAATGGCTGGGACTGCGTCCGAGACGCACAGCGCTCTGATGGGCTCCCTGGCCGACAAGGGCCGG
CGAATGCGTATCATTCGCCAATTCATCGCTCAGCCGCAGACGGTTCCGCACGTCCAGGCGCTACAGGACTGCCTC
TCGCGCCGTCTTGCCCACTTTGACGGCAGGCTGTCTGCCATCGAATCCCGCTTTGCCTTGCCTGAGGGTGAGGTC
GTCGTCAGTCTCTTGGCCGTTACGAGCGAGCTGGCCTCATGCTTGGAACCTGCTCTGGCTCTGTCCCGTATAGTG
TCACGGCTGCGAGAAGCTACCACGTCAGACACGTTCTACTGCTTGGAGCTTTTGTTTGATGAGATTGGCGTCACG
CAACTCGCGGGAAAGTCGGACACGTTCGAGGTGCTTGTCCGCGTCTTTATTGAATGCCTGAACATCTACCTGCGT
CCTGTTCAACTGTGGATGCGCGAGGGCAAGCTGCTTCCCGGGGACGAGTCTTTTTTCGTCACTGAGCCCTCTACA
CGTGTATCGTTGGGCGAGACCTGGCGATCTCGTTTCCAAATACGCAAGACGGCCGACGGAAGACCTCAGGCACCC
TCCTTTATCCAGCCGGCTGTCGGCGATATCTACAACGCCGGGAGGAACATGGTTGTGCTACGGCTGCTGGGAAAG
GCGACGACACAGCTCTCATCCAAGGCTGAGCCTCCTCTCGATTACGACGCGCTGTGTCCAGCAGGCTTCGAGCTC
GCCCCCTTTGCAGACTTGTTCTCCGCCGCTTTTGGTCGTTGGGTTCAGAGCCGGTGTTGCGAGACATGGGCCATC
CTGAAGCCAACGCTCGTGAAGGATTGGGGTCTGTTTGAGTCGCTCGACGCCCTGCAGGCCTTGTATCTCATGGCC
GATGGGCGCGCCGCGGGAACGCTCTGCTCGGCTCTATTTGCTGCCAAGGACACCGGCTGGCGTGATGGATACGCA
GTCACTATGACGGGTCGTGAGGCTTATGCCTTGCTGCGAGATCCAAGCCGGCTCGTCATTAGCTTCGATGAGGAT
CTGGTGAGAGGCAACGATTCCGTTCGGGCAGTGCTGCCGGTCATCAAGGTCAGCTACAGAGTGCCGTGGCCGGTG
CAGATGATTGTGACGACCGAGAGCATGGCGCATTACCAGTCCATCTTCACCCTTCTCTTGCAACTCAAGAAGGCC
ATGCACGCTCTGCACGAGGCGCGGCTCCCAGATGATTACGACGAGGATCGGCCACAGAGTTGTCTATTCTATTCC
ACCAGACACAAGCTCCTGTGGTTCTGCGCCACGATACACACATATCTCGCCACGCAGGTCTTGGAGCCAACCGCT
GTTCAGATGAAGCGTGACCTGGAATCAGCCAACAGCATCGAGGCAATGATTGCCGCTCAATGCAGAGCGATGAAG
CTCATGACGGAACAGGCGTGCCTCGGCCACGAGCTGACGTCTGTGCGAGAAAAGATGCTCGATATACTGGACCTG
GCTGTAAGACTCAACCACAGCCAGAATAGTGACTGTTCCGAAGACCTTGCCGAGACGGCGGTTCACTTGGACCAA
CACGCTCGCTTTGTTTGCCGGCAGCTGAGGAGTGTTGCGTCGGCGAACAGCAGCCTGTCGTCTGCGAAATGGCAT
GTTTTGGCAGACATGCTCCAGACAGGCGTGAGAGACGACGGCCGAAGCTTGAGATGA
Transcript >Ophun1|5863
ATGGCCTTTGCAGCGCGTCTCGGTCCCCTGACTGAAGACCTGCTACAGAGCCTGGCCCCGTCAGATACAGAGATT
GACACCCAGCTGCCCTCCTCATGGCTCCCCGACGCGGTCCTACGCAAGCTCAAGACTCACCCTTACCTGCGAACC
AATCCCTTCGAGATTGAGCAACGCCTCGAAGGTCTCGACGAGAAATTCCGTGTCAATAATCGCGAAGCTTTGGCC
GATGCTCTGCGTCTACGTCTGAGCTCCTTGTCGCAGCAACCCTCGCAATGGCACCCCGATGTGCTACATCTACTC
CTCGAGCTATCCGACCAACCGACCTTTAAATCCCGTCTCGATAGCCTTGATGCTTTGCAGCAGTCTCGCGAGCTG
CCGCCACAGGAACCTCCCCTGAAATGGGAACAGATCGCCCGCGAGGATGGCTGGGGCCGAGACGAGGATCTCTGG
AAGTCGACCAGCTACAGCAGCGATGGCTCCGTGGACGACGACACCGGCCTCGTCTCCGCTGTCGAGTCTTCAGAA
GCTACCTCTCTCGCTGGAGACGACGAGGCACCTGCCCGATCAGCCCAAGACTACATCGTCCATCCCGTGGCCTCG
GACGCTCTACAAGTTGTCCTTGAGGCTCAGTCCTGGCGAGCTATTCCGTCTGAGCCCTGCGTCGTCTCGGAGCTT
CAGGTAGTGCGCGACGTTCTTTTCATGCTTCGCGGACTCGATTGCTCCCTATTCGACTGCACAGGCCAGCCCGTC
CCCAGCTTCCGAATGGCTGGGACTGCGTCCGAGACGCACAGCGCTCTGATGGGCTCCCTGGCCGACAAGGGCCGG
CGAATGCGTATCATTCGCCAATTCATCGCTCAGCCGCAGACGGTTCCGCACGTCCAGGCGCTACAGGACTGCCTC
TCGCGCCGTCTTGCCCACTTTGACGGCAGGCTGTCTGCCATCGAATCCCGCTTTGCCTTGCCTGAGGGTGAGGTC
GTCGTCAGTCTCTTGGCCGTTACGAGCGAGCTGGCCTCATGCTTGGAACCTGCTCTGGCTCTGTCCCGTATAGTG
TCACGGCTGCGAGAAGCTACCACGTCAGACACGTTCTACTGCTTGGAGCTTTTGTTTGATGAGATTGGCGTCACG
CAACTCGCGGGAAAGTCGGACACGTTCGAGGTGCTTGTCCGCGTCTTTATTGAATGCCTGAACATCTACCTGCGT
CCTGTTCAACTGTGGATGCGCGAGGGCAAGCTGCTTCCCGGGGACGAGTCTTTTTTCGTCACTGAGCCCTCTACA
CGTGTATCGTTGGGCGAGACCTGGCGATCTCGTTTCCAAATACGCAAGACGGCCGACGGAAGACCTCAGGCACCC
TCCTTTATCCAGCCGGCTGTCGGCGATATCTACAACGCCGGGAGGAACATGGTTGTGCTACGGCTGCTGGGAAAG
GCGACGACACAGCTCTCATCCAAGGCTGAGCCTCCTCTCGATTACGACGCGCTGTGTCCAGCAGGCTTCGAGCTC
GCCCCCTTTGCAGACTTGTTCTCCGCCGCTTTTGGTCGTTGGGTTCAGAGCCGGTGTTGCGAGACATGGGCCATC
CTGAAGCCAACGCTCGTGAAGGATTGGGGTCTGTTTGAGTCGCTCGACGCCCTGCAGGCCTTGTATCTCATGGCC
GATGGGCGCGCCGCGGGAACGCTCTGCTCGGCTCTATTTGCTGCCAAGGACACCGGCTGGCGTGATGGATACGCA
GTCACTATGACGGGTCGTGAGGCTTATGCCTTGCTGCGAGATCCAAGCCGGCTCGTCATTAGCTTCGATGAGGAT
CTGGTGAGAGGCAACGATTCCGTTCGGGCAGTGCTGCCGGTCATCAAGGTCAGCTACAGAGTGCCGTGGCCGGTG
CAGATGATTGTGACGACCGAGAGCATGGCGCATTACCAGTCCATCTTCACCCTTCTCTTGCAACTCAAGAAGGCC
ATGCACGCTCTGCACGAGGCGCGGCTCCCAGATGATTACGACGAGGATCGGCCACAGAGTTGTCTATTCTATTCC
ACCAGACACAAGCTCCTGTGGTTCTGCGCCACGATACACACATATCTCGCCACGCAGGTCTTGGAGCCAACCGCT
GTTCAGATGAAGCGTGACCTGGAATCAGCCAACAGCATCGAGGCAATGATTGCCGCTCAATGCAGAGCGATGAAG
CTCATGACGGAACAGGCGTGCCTCGGCCACGAGCTGACGTCTGTGCGAGAAAAGATGCTCGATATACTGGACCTG
GCTGTAAGACTCAACCACAGCCAGAATAGTGACTGTTCCGAAGACCTTGCCGAGACGGCGGTTCACTTGGACCAA
CACGCTCGCTTTGTTTGCCGGCAGCTGAGGAGTGTTGCGTCGGCGAACAGCAGCCTGTCGTCTGCGAAATGGCAT
GTTTTGGCAGACATGCTCCAGACAGGCGTGAGAGACGACGGCCGAAGCTTGAGATGA
Gene >Ophun1|5863
ATGGCCTTTGCAGCGCGTCTCGGTCCCCTGACTGAAGACCTGCTACAGAGCCTGGCCCCGTCAGATACAGAGATT
GACACCCAGCTGCCCTCCTCATGGCTCCCCGACGCGGTCCTACGCAAGCTCAAGACTCACCCTTACCTGCGAACC
AATCCCTTCGAGATTGAGCAACGCCTCGAAGGTCTCGACGAGAAATTCCGTGTCAATAATCGCGAAGCTTTGGCC
GATGCTCTGCGTCTACGTCTGAGCTCCTTGTCGCAGCAACCCTCGCAATGGCACCCCGATGTGCTACATCTACTC
CTCGAGCTATCCGACCAACCGACCTTTAAATCCCGTCTCGATAGCCTTGATGCTTTGCAGCAGTCTCGCGAGCTG
CCGCCACAGGAACCTCCCCTGAAATGGGAACAGATCGCCCGCGAGGATGGCTGGGGCCGAGACGAGGATCTCTGG
AAGTCGACCAGCTACAGCAGCGATGGCTCCGTGGACGACGACACCGGCCTCGTCTCCGCTGTCGAGTCTTCAGAA
GCTACCTCTCTCGCTGGAGACGACGAGGCACCTGCCCGATCAGCCCAAGACTACATCGTCCATCCCGTGGCCTCG
GACGCTCTACAAGTTGTCCTTGAGGCTCAGTCCTGGCGAGCTATTCCGTCTGAGCCCTGCGTCGTCTCGGAGCTT
CAGGTAGTGCGCGACGTTCTTTTCATGCTTCGCGGACTCGATTGCTCCCTATTCGACTGCACAGGCCAGCCCGTC
CCCAGCTTCCGAATGGCTGGGACTGCGTCCGAGACGCACAGCGCTCTGATGGGCTCCCTGGCCGACAAGGGCCGG
CGAATGCGTATCATTCGCCAATTCATCGCTCAGCCGCAGACGGTTCCGCACGTCCAGGCGCTACAGGACTGCCTC
TCGCGCCGTCTTGCCCACTTTGACGGCAGGCTGTCTGCCATCGAATCCCGCTTTGCCTTGCCTGAGGGTGAGGTC
GTCGTCAGTCTCTTGGCCGTTACGAGCGAGCTGGCCTCATGCTTGGAACCTGCTCTGGCTCTGTCCCGTATAGTG
TCACGGCTGCGAGAAGCTACCACGTCAGACACGTTCTACTGCTTGGAGCTTTTGTTTGATGAGATTGGCGTCACG
CAACTCGCGGGAAAGTCGGACACGTTCGAGGTGCTTGTCCGCGTCTTTATTGAATGCCTGAACATCTACCTGCGT
CCTGTTCAACTGTGGATGCGCGAGGGCAAGCTGCTTCCCGGGGACGAGTCTTTTTTCGTCACTGAGCCCTCTACA
CGTGTATCGTTGGGCGAGACCTGGCGATCTCGTTTCCAAATACGCAAGACGGCCGACGGAAGACCTCAGGCACCC
TCCTTTATCCAGCCGGCTGTCGGCGATATCTACAACGCCGGGAGGAACATGGTTGTGCTACGGCTGCTGGGAAAG
GCGACGACACAGCTCTCATCCAAGGCTGAGCCTCCTCTCGATTACGACGCGCTGTGTCCAGCAGGCTTCGAGCTC
GCCCCCTTTGCAGACTTGTTCTCCGCCGCTTTTGGTCGTTGGGTTCAGAGCCGGTGTTGCGAGACATGGGCCATC
CTGAAGCCAACGCTCGTGAAGGATTGGGGTCTGTTTGAGTCGCTCGACGCCCTGCAGGCCTTGTATCTCATGGCC
GATGGGCGCGCCGCGGGAACGCTCTGCTCGGCTCTATTTGCTGCCAAGGACACCGGCTGGCGTGATGGATACGCA
GTCACTATGACGGGTCGTGAGGCTTATGCCTTGCTGCGAGATCCAAGCCGGCTCGTCATTAGCTTCGATGAGGAT
CTGGTGAGAGGCAACGATTCCGTTCGGGCAGTGCTGCCGGTCATCAAGGTCAGCTACAGAGTGCCGTGGCCGGTG
CAGATGATTGTGACGACCGAGAGCATGGCGCATTACCAGTCCATCTTCACCCTTCTCTTGCAACTCAAGAAGGCC
ATGCACGCTCTGCACGAGGCGCGGCTCCCAGATGATTACGACGAGGATCGGCCACAGAGTTGTCTATTCTATTCC
ACCAGACACAAGCTCCTGTGGTTCTGCGCCACGATACACACATATCTCGCCACGCAGGTCTTGGAGCCAACCGCT
GTTCAGATGAAGCGTGACCTGGAATCAGCCAACAGCATCGAGGCAATGATTGCCGCTCAATGCAGAGCGATGAAG
CTCATGACGGAACAGGCGTGCCTCGGCCACGAGCTGACGTCTGTGCGAGAAAAGATGCTCGATATACTGGACCTG
GCTGTAAGACTCAACCACAGCCAGAATAGTGACTGTTCCGAAGACCTTGCCGAGACGGCGGTTCACTTGGACCAA
CACGCTCGCTTTGTTTGCCGGCAGCTGAGGAGTGTTGCGTCGGCGAACAGCAGCCTGTCGTCTGCGAAATGGCAT
GTTTTGGCAGACATGCTCCAGACAGGCGTGAGAGACGACGGCCGAAGCTTGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail