Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5862
Gene name
LocationContig_60:37387..38104
Strand+
Gene length (bp)717
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase 9.9E-14 26 195

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14304|YE88_SCHPO Uncharacterized hydrolase C9G1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.08c PE=3 SV=1 31 235 1.0E-15
sp|P0CT29|YU204_USTMA Uncharacterized hydrolase UM10204 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10204 PE=3 SV=1 29 179 2.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5862
MPPRIPTEADFANCPPLALTFPDPPESTTAILILLHGLGDSEIPFAGFARAMALPGVLAISVRGVAPLPSALMLS
GADGAHFHWGDDLTFDSQTGDVDADPGFQQARRVIVDGLIRGVLVQKCGWDLDDVLLFGFGQGGSLALGLASRLR
EAGSDTFKGVVSIGGPLPVSMVPTTSSRTKSDTKVLLCQLDEDAVDAVESEFSHVKVVKWKRRDVAMPRDRDEML
PIMKFFADQLKTI*
Coding >Ophun1|5862
ATGCCGCCACGGATCCCAACAGAAGCCGACTTCGCCAACTGCCCCCCGCTGGCCCTCACCTTCCCCGATCCGCCC
GAGTCGACGACAGCCATCCTCATCCTCCTGCACGGCCTCGGAGACAGCGAGATCCCCTTCGCCGGCTTCGCGCGC
GCAATGGCCCTCCCCGGCGTGCTGGCCATCTCTGTCCGCGGTGTTGCGCCGCTGCCGTCTGCTCTGATGCTCTCC
GGTGCGGACGGCGCGCATTTCCATTGGGGTGACGACCTGACCTTTGATTCGCAAACGGGCGACGTCGATGCCGAT
CCTGGTTTTCAGCAAGCCCGTCGCGTCATTGTTGACGGTCTTATTCGTGGCGTCCTCGTTCAAAAGTGCGGCTGG
GATCTGGATGACGTTCTCCTCTTTGGCTTCGGTCAGGGCGGCTCGCTGGCCTTGGGGCTGGCTTCCCGCCTGCGT
GAGGCTGGTTCTGATACGTTCAAGGGTGTCGTCTCCATCGGCGGACCGTTGCCCGTGTCCATGGTCCCGACGACG
AGCTCGCGCACCAAGAGCGACACCAAGGTGCTATTGTGTCAATTGGATGAGGACGCAGTCGACGCTGTTGAGTCC
GAGTTCAGCCATGTCAAGGTCGTCAAATGGAAGCGAAGAGACGTGGCGATGCCGCGCGATAGGGACGAGATGTTG
CCTATCATGAAGTTCTTTGCCGACCAGCTAAAGACGATATGA
Transcript >Ophun1|5862
ATGCCGCCACGGATCCCAACAGAAGCCGACTTCGCCAACTGCCCCCCGCTGGCCCTCACCTTCCCCGATCCGCCC
GAGTCGACGACAGCCATCCTCATCCTCCTGCACGGCCTCGGAGACAGCGAGATCCCCTTCGCCGGCTTCGCGCGC
GCAATGGCCCTCCCCGGCGTGCTGGCCATCTCTGTCCGCGGTGTTGCGCCGCTGCCGTCTGCTCTGATGCTCTCC
GGTGCGGACGGCGCGCATTTCCATTGGGGTGACGACCTGACCTTTGATTCGCAAACGGGCGACGTCGATGCCGAT
CCTGGTTTTCAGCAAGCCCGTCGCGTCATTGTTGACGGTCTTATTCGTGGCGTCCTCGTTCAAAAGTGCGGCTGG
GATCTGGATGACGTTCTCCTCTTTGGCTTCGGTCAGGGCGGCTCGCTGGCCTTGGGGCTGGCTTCCCGCCTGCGT
GAGGCTGGTTCTGATACGTTCAAGGGTGTCGTCTCCATCGGCGGACCGTTGCCCGTGTCCATGGTCCCGACGACG
AGCTCGCGCACCAAGAGCGACACCAAGGTGCTATTGTGTCAATTGGATGAGGACGCAGTCGACGCTGTTGAGTCC
GAGTTCAGCCATGTCAAGGTCGTCAAATGGAAGCGAAGAGACGTGGCGATGCCGCGCGATAGGGACGAGATGTTG
CCTATCATGAAGTTCTTTGCCGACCAGCTAAAGACGATATGA
Gene >Ophun1|5862
ATGCCGCCACGGATCCCAACAGAAGCCGACTTCGCCAACTGCCCCCCGCTGGCCCTCACCTTCCCCGATCCGCCC
GAGTCGACGACAGCCATCCTCATCCTCCTGCACGGCCTCGGAGACAGCGAGATCCCCTTCGCCGGCTTCGCGCGC
GCAATGGCCCTCCCCGGCGTGCTGGCCATCTCTGTCCGCGGTGTTGCGCCGCTGCCGTCTGCTCTGATGCTCTCC
GGTGCGGACGGCGCGCATTTCCATTGGGGTGACGACCTGACCTTTGATTCGCAAACGGGCGACGTCGATGCCGAT
CCTGGTTTTCAGCAAGCCCGTCGCGTCATTGTTGACGGTCTTATTCGTGGCGTCCTCGTTCAAAAGTGCGGCTGG
GATCTGGATGACGTTCTCCTCTTTGGCTTCGGTCAGGGCGGCTCGCTGGCCTTGGGGCTGGCTTCCCGCCTGCGT
GAGGCTGGTTCTGATACGTTCAAGGGTGTCGTCTCCATCGGCGGACCGTTGCCCGTGTCCATGGTCCCGACGACG
AGCTCGCGCACCAAGAGCGACACCAAGGTGCTATTGTGTCAATTGGATGAGGACGCAGTCGACGCTGTTGAGTCC
GAGTTCAGCCATGTCAAGGTCGTCAAATGGAAGCGAAGAGACGTGGCGATGCCGCGCGATAGGGACGAGATGTTG
CCTATCATGAAGTTCTTTGCCGACCAGCTAAAGACGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail