Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5854
Gene name
LocationContig_60:20003..21510
Strand-
Gene length (bp)1507
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14027 Questin_oxidase Questin oxidase-like 2.2E-75 39 360

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6UEF1|AFLY_ASPPA Oxidoreductase AflY OS=Aspergillus parasiticus GN=aflY PE=4 SV=1 2 367 7.0E-47

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5854
MATPYRFNITAADTGLLKVKQDDAAATRLTELLQQDLELLTLYGTGSTAEGLSKAYDQNKTYQLPARKPSTSTAD
SLSNWSANAAPLLGNDAHYADFLLYFQRAIDEKGWQAVVADHLLGDSPACLDMLGRLCAGFYHPAIQLMYGMEWE
QPALVAEGLAQAAVHDARVADLMREVDEAAKTRDEVAVQSLPALLEGIREQQPKLAASARWEDPNRIFDGVLARA
RPEAVALLAGIRVRPDELEEKTAEMIHTAAYVAAAASWNPPYTPKYDFFLLHHLTASPLFLTLNKLPTITTTAKA
RLLTWKIRMDIIGYLARGCPPLRRSDTLPVPAGVKRAGDLLPRFREIVDDGHVIKVVRSLLLAEEVSGR*
Coding >Ophun1|5854
ATGGCGACGCCCTACCGCTTCAACATTACCGCTGCCGATACCGGCTTGCTCAAGGTCAAGCAGGATGATGCTGCT
GCTACGCGTCTGACTGAACTGCTGCAGCAGGATCTCGAGCTCCTCACCCTCTACGGAACAGGCAGCACAGCAGAA
GGCCTCAGCAAAGCCTACGACCAGAACAAAACCTACCAGCTCCCCGCCCGCAAACCCTCAACCTCCACCGCCGAC
TCCCTCAGCAACTGGTCCGCCAACGCAGCGCCCCTCCTCGGCAACGACGCCCACTACGCCGATTTCCTCCTCTAC
TTCCAGCGCGCCATCGATGAAAAGGGCTGGCAGGCGGTCGTCGCAGACCACCTCCTCGGTGACTCCCCCGCCTGT
CTCGACATGCTGGGCAGGCTTTGCGCCGGCTTCTACCACCCGGCTATCCAGCTCATGTACGGCATGGAGTGGGAG
CAGCCAGCCCTCGTCGCCGAGGGTCTCGCCCAGGCGGCCGTTCACGACGCGCGCGTTGCGGATTTGATGCGCGAG
GTAGACGAGGCAGCCAAGACGCGAGACGAGGTGGCCGTCCAGTCTCTCCCCGCGCTGCTGGAGGGGATCCGCGAG
CAGCAGCCCAAGTTGGCGGCCAGTGCGCGCTGGGAGGATCCCAATCGCATCTTTGATGGTGTGCTGGCCAGGGCT
AGGCCTGAGGCTGTGGCTTTGCTTGCGGGCATTCGCGTTAGGCCTGATGAGTTGGAGGAGAAGACGGCTGAGATG
ATCCATACGGCTGCCTATGTCGCTGCCGCTGCGTCTTGGAACCCGCCTTACACGCCCAAATACGACTTCTTCCTC
CTCCACCACCTAACCGCCTCCCCCCTCTTCCTAACCCTCAACAAACTCCCCACCATAACCACCACCGCCAAAGCC
CGCCTCCTAACATGGAAGATCCGAATGGACATAATCGGCTACCTGGCCCGCGGCTGCCCGCCCCTCCGCCGCAGC
GACACCCTCCCCGTGCCGGCGGGGGTCAAGCGCGCGGGCGACCTGCTGCCGCGGTTCCGCGAGATTGTGGATGAT
GGCCATGTCATCAAGGTGGTGCGCTCGTTGTTGCTGGCGGAGGAGGTTTCGGGGAGGTGA
Transcript >Ophun1|5854
ATGGCGACGCCCTACCGCTTCAACATTACCGCTGCCGATACCGGCTTGCTCAAGGTCAAGCAGGATGATGCTGCT
GCTACGCGTCTGACTGAACTGCTGCAGCAGGATCTCGAGCTCCTCACCCTCTACGGAACAGGCAGCACAGCAGAA
GGCCTCAGCAAAGCCTACGACCAGAACAAAACCTACCAGCTCCCCGCCCGCAAACCCTCAACCTCCACCGCCGAC
TCCCTCAGCAACTGGTCCGCCAACGCAGCGCCCCTCCTCGGCAACGACGCCCACTACGCCGATTTCCTCCTCTAC
TTCCAGCGCGCCATCGATGAAAAGGGCTGGCAGGCGGTCGTCGCAGACCACCTCCTCGGTGACTCCCCCGCCTGT
CTCGACATGCTGGGCAGGCTTTGCGCCGGCTTCTACCACCCGGCTATCCAGCTCATGTACGGCATGGAGTGGGAG
CAGCCAGCCCTCGTCGCCGAGGGTCTCGCCCAGGCGGCCGTTCACGACGCGCGCGTTGCGGATTTGATGCGCGAG
GTAGACGAGGCAGCCAAGACGCGAGACGAGGTGGCCGTCCAGTCTCTCCCCGCGCTGCTGGAGGGGATCCGCGAG
CAGCAGCCCAAGTTGGCGGCCAGTGCGCGCTGGGAGGATCCCAATCGCATCTTTGATGGTGTGCTGGCCAGGGCT
AGGCCTGAGGCTGTGGCTTTGCTTGCGGGCATTCGCGTTAGGCCTGATGAGTTGGAGGAGAAGACGGCTGAGATG
ATCCATACGGCTGCCTATGTCGCTGCCGCTGCGTCTTGGAACCCGCCTTACACGCCCAAATACGACTTCTTCCTC
CTCCACCACCTAACCGCCTCCCCCCTCTTCCTAACCCTCAACAAACTCCCCACCATAACCACCACCGCCAAAGCC
CGCCTCCTAACATGGAAGATCCGAATGGACATAATCGGCTACCTGGCCCGCGGCTGCCCGCCCCTCCGCCGCAGC
GACACCCTCCCCGTGCCGGCGGGGGTCAAGCGCGCGGGCGACCTGCTGCCGCGGTTCCGCGAGATTGTGGATGAT
GGCCATGTCATCAAGGTGGTGCGCTCGTTGTTGCTGGCGGAGGAGGTTTCGGGGAGGTGA
Gene >Ophun1|5854
ATGGCGACGCCCTACCGCTTCAACATTACCGCTGCCGATACCGGCTTGCTCAAGGTCAAGCAGGATGATGCTGCT
GCTACGCGTCTGACTGAACTGCTGCAGCAGGATCTCGAGGTGAGGCTTTGTGCTTAGACTGTTGCTCTGCTGCTT
ACCCGTCTCTCTAAGAAACATCACGTCTTCTTCAACGACTCCGGCTTCCACAACCACGTACTTCTCCCCAACTCT
CTTCCCCCGAGCCTACCTACATCTAAACACCACGCAGATCGCACACCAGCTCCTCACCCTCTACGGAACAGGCAG
CACAGCAGAAGGCCTCAGCAAAGCCTACGACCAGAACAAAACCTACCAGCTCCCCGCCCGCAAACCCTCAACCTC
CACCGCCGACTCCCTCAGCAACTGGTCCGCCAACGCAGCGCCCCTCCTCGGCAACGACGCCCACTACGCCGATTT
CCTCCTCTACTTCCAGCGCGCCATCGATGAAAAGGGCTGGCAGGCGGTCGTCGCAGACCACCTCCTCGGTGACTC
CCCCGCCTGTCTCGACATGCTGGGCAGGCTTTGCGCCGGCTTCTACCACCCGGCTATCCAGCTCATGTACGGCAT
GGAGTGGGAGCAGCCAGCCCTCGTCGCCGAGGGTCTCGCCCAGGCGGCCGTTCACGACGCGCGCGTTGCGGATTT
GATGCGCGAGGTAGACGAGGCAGCCAAGACGCGAGACGAGGTGGCCGTCCAGTCTCTCCCCGCGCTGCTGGAGGG
GATCCGCGAGCAGCAGCCCAAGTTGGCGGCCAGTGCGCGCTGGGAGGATCCCAATCGCATCTTTGATGGTGTGCT
GGCCAGGGCTAGGCCTGAGGCTGTGGCTTTGCTTGCGGGCATTCGCGTTAGGCCTGATGAGTTGGAGGAGAAGAC
GGCTGAGATGATCCATACGGCTGCCTATGTCGCTGCCGCTGCGTCTTGGAACCCGCCTTACACGCCCAAATACGA
CTTCTTCCTCCTGTACGATTCCCCCTTTTCCCCTATCAAGCAAGATATCTAACCCCCCTATAGCCACCACCTAAC
CGCCTCCCCCCTCTTCCTAACCCTCAACAAACTCCCCACCATAACCACCACCGCCAAAGCCCGCCTCCTAACATG
GAAGATCCGAATGGACATAATCGGCTACCTGGCCCGCGGCTGCCCGCCCCTCCGCCGCAGCGACACCCTCCCCGT
GCCGGCGGGGGTCAAGCGCGCGGGCGACCTGCTGCCGCGGTTCCGCGAGATTGTGGATGATGGCCATGTCATCAA
GGTGGTGCGCTCGTTGTTGCTGGCGGAGGAGGTTTCGGGGAGGTGGGCGGGGAGGGATTGGGTGCGGTTGAGGGA
TGAGGGGGATTGGGTGTGGGCTATGAATCTTTTGTTGAGGGGGTGTGAGGGGGAGGGGTTGGGGAGGATTTGGGT
GAGGTCTGCTGGGTTTCCGGAGGCGTGGAAGGATATGCCTAAGATGGAGGAGTAATGGGAGATTGATGTTGAGGG
CAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail