Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5851
Gene name
LocationContig_60:12829..14420
Strand+
Gene length (bp)1591
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase 1.9E-46 61 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53170|PDK2_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP2 PE=1 SV=3 50 447 2.0E-67
sp|Q2KJG8|BCKD_BOVIN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1 38 447 9.0E-48
sp|O14874|BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2 37 447 2.0E-47
sp|O55028|BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1 38 447 6.0E-47
sp|Q00972|BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2 38 447 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53170|PDK2_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP2 PE=1 SV=3 50 447 2.0E-67
sp|Q2KJG8|BCKD_BOVIN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1 38 447 9.0E-48
sp|O14874|BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2 37 447 2.0E-47
sp|O55028|BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1 38 447 6.0E-47
sp|Q00972|BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2 38 447 1.0E-46
sp|Q9SBJ1|PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana GN=PDK PE=1 SV=1 53 447 7.0E-46
sp|P91622|PDK_DROME [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2 50 447 1.0E-31
sp|O88345|PDK4_ICTTR [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Ictidomys tridecemlineatus GN=PDK4 PE=2 SV=1 61 444 2.0E-29
sp|Q16654|PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens GN=PDK4 PE=1 SV=1 61 444 9.0E-29
sp|O70571|PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus GN=Pdk4 PE=1 SV=1 61 444 6.0E-28
sp|O54937|PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus GN=Pdk4 PE=1 SV=1 61 444 6.0E-28
sp|Q1KMR4|PDK4_RHIFE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rhinolophus ferrumequinum GN=PDK4 PE=2 SV=1 37 444 8.0E-28
sp|Q64536|PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus GN=Pdk2 PE=1 SV=1 61 440 9.0E-25
sp|Q9JK42|PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus GN=Pdk2 PE=1 SV=2 61 440 4.0E-24
sp|Q922H2|PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus GN=Pdk3 PE=1 SV=1 61 444 5.0E-24
sp|Q63065|PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus GN=Pdk1 PE=1 SV=1 51 444 7.0E-24
sp|Q15120|PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1 61 444 1.0E-23
sp|Q8BFP9|PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus GN=Pdk1 PE=1 SV=2 51 444 1.0E-23
sp|Q15119|PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens GN=PDK2 PE=1 SV=2 61 440 5.0E-23
sp|Q15118|PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens GN=PDK1 PE=1 SV=1 51 440 3.0E-22
sp|Q9P6P9|PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkp1 PE=3 SV=1 180 447 5.0E-22
sp|O02623|PDK_ASCSU [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Ascaris suum PE=2 SV=1 51 435 7.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5851
MASMPLRRAGRRCRLTGLSAPLLRDSPPSTGLQRPVSRNSSSASWRPVTVLDEWVAREARPISLRQLMVFGRSLT
ESRLISSANYVRTELPVRIAHRIRDMQRLPYAVVTNNHINDVYNLYCHAFDTFRKLPEVKTLDDNDRLCEVISQT
LKGHLTVIPKLAMGILECGGLMDPSYLDSFMNTILRSRISRRVIAEQHLSLTETFNSPYFSAGAKLSEADFIGEV
FIKCSAKDVIVRCAEAVTALARSTNGPDVAVPAIRVLGHLDASFPYILSHIDYIIGELLRNSVQAVIDRRRCDPE
TSISGSEPPPVDVTVCEAQEHVIFRISDQGGGIPRHQLPYLWSFSKGPQSQARLHNLGQVPRMAATTQDLHVREE
LARADLKTPSAYQSSLSSLTVRPPNLRLGIGLPLSRVYAEYWAGSLNLHNLEGYGVDAFLQISRLGNKNEQLTTR
ASMDAV*
Coding >Ophun1|5851
ATGGCCTCCATGCCGCTGCGCCGAGCCGGCCGGCGATGCCGACTGACCGGCCTCTCGGCGCCGCTCCTCCGAGAC
TCGCCCCCGTCCACCGGCCTGCAGCGGCCCGTGTCGCGCAACTCGAGCAGTGCCTCGTGGCGGCCCGTCACCGTA
CTGGACGAATGGGTTGCGCGCGAGGCCCGTCCCATCAGCCTCCGCCAGCTCATGGTCTTTGGCCGCTCCTTGACC
GAGTCGCGCCTCATCAGCTCCGCCAACTACGTCCGCACCGAACTTCCCGTCCGCATCGCCCATCGCATCCGCGAC
ATGCAACGCCTACCCTACGCCGTCGTCACCAACAACCACATCAACGACGTCTATAACCTCTACTGTCACGCCTTT
GACACTTTTCGCAAACTGCCCGAGGTCAAGACGCTAGACGACAACGACCGGCTCTGTGAAGTCATCAGCCAGACG
CTCAAGGGGCATCTGACGGTGATACCCAAGCTGGCCATGGGAATCCTCGAGTGCGGCGGCCTCATGGACCCGTCC
TACCTCGACTCCTTCATGAACACCATCTTGAGATCGCGTATATCCCGTCGTGTCATCGCCGAACAACATCTCTCC
TTAACCGAAACCTTCAACTCCCCCTACTTCTCCGCCGGAGCCAAACTATCAGAAGCCGACTTCATCGGCGAAGTC
TTCATCAAATGCTCAGCCAAAGACGTCATCGTCCGCTGCGCCGAAGCCGTCACCGCTCTCGCCCGCTCGACAAAC
GGCCCAGACGTAGCCGTGCCCGCCATCCGCGTCCTCGGCCACCTCGACGCCAGCTTCCCCTACATCCTCAGCCAC
ATCGACTACATCATCGGTGAACTGCTTCGCAACTCGGTCCAGGCCGTCATTGACCGCCGCCGCTGCGACCCCGAG
ACCTCGATATCCGGTTCGGAACCCCCTCCCGTCGACGTCACCGTCTGCGAGGCTCAGGAGCACGTCATCTTCCGC
ATCTCCGACCAGGGCGGCGGCATCCCCCGTCACCAGCTGCCCTACCTCTGGTCCTTCTCCAAGGGTCCCCAGAGT
CAGGCTCGACTTCACAATCTCGGTCAGGTTCCTCGGATGGCCGCCACCACTCAGGATCTGCACGTCCGCGAAGAG
CTGGCCCGTGCCGACCTCAAGACTCCCTCGGCCTACCAGAGCTCCCTCTCCTCGCTAACCGTCCGGCCACCGAAT
CTGCGTCTCGGCATCGGCCTACCTCTCAGTCGCGTCTACGCCGAGTATTGGGCCGGCAGCCTCAATCTACACAAC
CTCGAGGGCTACGGTGTCGACGCCTTTCTCCAGATCTCGCGCCTGGGCAATAAGAACGAGCAGCTGACAACCAGG
GCCAGCATGGATGCCGTGTGA
Transcript >Ophun1|5851
ATGGCCTCCATGCCGCTGCGCCGAGCCGGCCGGCGATGCCGACTGACCGGCCTCTCGGCGCCGCTCCTCCGAGAC
TCGCCCCCGTCCACCGGCCTGCAGCGGCCCGTGTCGCGCAACTCGAGCAGTGCCTCGTGGCGGCCCGTCACCGTA
CTGGACGAATGGGTTGCGCGCGAGGCCCGTCCCATCAGCCTCCGCCAGCTCATGGTCTTTGGCCGCTCCTTGACC
GAGTCGCGCCTCATCAGCTCCGCCAACTACGTCCGCACCGAACTTCCCGTCCGCATCGCCCATCGCATCCGCGAC
ATGCAACGCCTACCCTACGCCGTCGTCACCAACAACCACATCAACGACGTCTATAACCTCTACTGTCACGCCTTT
GACACTTTTCGCAAACTGCCCGAGGTCAAGACGCTAGACGACAACGACCGGCTCTGTGAAGTCATCAGCCAGACG
CTCAAGGGGCATCTGACGGTGATACCCAAGCTGGCCATGGGAATCCTCGAGTGCGGCGGCCTCATGGACCCGTCC
TACCTCGACTCCTTCATGAACACCATCTTGAGATCGCGTATATCCCGTCGTGTCATCGCCGAACAACATCTCTCC
TTAACCGAAACCTTCAACTCCCCCTACTTCTCCGCCGGAGCCAAACTATCAGAAGCCGACTTCATCGGCGAAGTC
TTCATCAAATGCTCAGCCAAAGACGTCATCGTCCGCTGCGCCGAAGCCGTCACCGCTCTCGCCCGCTCGACAAAC
GGCCCAGACGTAGCCGTGCCCGCCATCCGCGTCCTCGGCCACCTCGACGCCAGCTTCCCCTACATCCTCAGCCAC
ATCGACTACATCATCGGTGAACTGCTTCGCAACTCGGTCCAGGCCGTCATTGACCGCCGCCGCTGCGACCCCGAG
ACCTCGATATCCGGTTCGGAACCCCCTCCCGTCGACGTCACCGTCTGCGAGGCTCAGGAGCACGTCATCTTCCGC
ATCTCCGACCAGGGCGGCGGCATCCCCCGTCACCAGCTGCCCTACCTCTGGTCCTTCTCCAAGGGTCCCCAGAGT
CAGGCTCGACTTCACAATCTCGGTCAGGTTCCTCGGATGGCCGCCACCACTCAGGATCTGCACGTCCGCGAAGAG
CTGGCCCGTGCCGACCTCAAGACTCCCTCGGCCTACCAGAGCTCCCTCTCCTCGCTAACCGTCCGGCCACCGAAT
CTGCGTCTCGGCATCGGCCTACCTCTCAGTCGCGTCTACGCCGAGTATTGGGCCGGCAGCCTCAATCTACACAAC
CTCGAGGGCTACGGTGTCGACGCCTTTCTCCAGATCTCGCGCCTGGGCAATAAGAACGAGCAGCTGACAACCAGG
GCCAGCATGGATGCCGTGTGA
Gene >Ophun1|5851
ATGGCCTCCATGCCGCTGCGCCGAGCCGGCCGGCGATGCCGACTGACCGGCCTCTCGGCGCCGCTCCTCCGAGAC
TCGCCCCCGTCCACCGGCCTGCAGCGGCCCGTGTCGCGCAACTCGAGCAGTGCCTCGTGGCGGCCCGTCACCGTA
CTGGACGAGTACTGTTCCCATCAATCTCCCCCGTCCAGGTTACATGGCTTCGCCGGCTAACTGTTCCTGCTCTTC
AGATGGGTTGCGCGCGAGGCCCGTCCCATCAGCCTCCGCCAGCTCATGGTCTTTGGCCGCTCCTTGACCGAGTCG
CGCCTCATCAGCTCCGCCAACTACGTCCGCACCGAACTTCCCGTCCGGTGAGCACGGGCGAGCATCTCTCTCAGC
TCGAATCGACTGACGTGCTGCCACCAGCATCGCCCATCGCATCCGCGACATGCAACGCCTACCCTACGCCGTCGT
CACCAACAACCACATCAACGACGTCTATAACCTCTACTGTCACGCCTTTGACACTTTTCGCAAACTGCCCGAGGT
CAAGACGCTAGACGACAACGACCGGCTCTGTGAAGTCATCAGCCAGACGCTCAAGGGGCATCTGACGGTGATACC
CAAGCTGGCCATGGGAATCCTCGAGTGCGGCGGCCTCATGGACCCGTCCTACCTCGACTCCTTCATGAACACCAT
CTTGAGATCGGTACGGAACCCCTGTTCTATAGATCTCTCTCTCCTTGTCATTATACCTATACTCGGAATATGTGA
GCTGACGCTCCTCTCTCACCACCCTTTTCAGCGTATATCCCGTCGTGTCATCGCCGAACAACATCTCTCCTTAAC
CGAAACCTTCAACTCCCCCTACTTCTCCGCCGGAGCCAAACTATCAGAAGCCGACTTCATCGGCGAAGTCTTCAT
CAAATGCTCAGCCAAAGACGTCATCGTCCGCTGCGCCGAAGCCGTCACCGCTCTCGCCCGCTCGACAAACGGCCC
AGACGTAGCCGTGCCCGCCATCCGCGTCCTCGGCCACCTCGACGCCAGCTTCCCCTACATCCTCAGCCACATCGA
CTACATCATCGGTGAACTGCTTCGCAACTCGGTCCAGGCCGTCATTGACCGCCGCCGCTGCGACCCCGAGACCTC
GATATCCGGTTCGGAACCCCCTCCCGTCGACGTCACCGTCTGCGAGGCTCAGGAGCACGTCATCTTCCGCATCTC
CGACCAGGGCGGCGGCATCCCCCGTCACCAGCTGCCCTACCTCTGGTCCTTCTCCAAGGGTCCCCAGAGTCAGGC
TCGACTTCACAATCTCGGTCAGGTTCCTCGGATGGCCGCCACCACTCAGGATCTGCACGTCCGCGAAGAGCTGGC
CCGTGCCGACCTCAAGACTCCCTCGGCCTACCAGAGCTCCCTCTCCTCGCTAACCGTCCGGCCACCGAATCTGCG
TCTCGGCATCGGCCTACCTCTCAGTCGCGTCTACGCCGAGTATTGGGCCGGCAGCCTCAATCTACACAACCTCGA
GGGCTACGGTGTCGACGCCTTTCTCCAGATCTCGCGCCTGGGCAATAAGAACGAGCAGCTGACAACCAGGGCCAG
CATGGATGCCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail