Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5844
Gene name
LocationContig_6:87783..90794
Strand+
Gene length (bp)3011
Transcript length (bp)2943
Coding sequence length (bp)2943
Protein length (aa) 981

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 3.9E-36 652 971

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 651 980 3.0E-124
sp|O13657|YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi066 PE=1 SV=1 635 975 7.0E-116
sp|P43553|ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR2 PE=1 SV=1 646 974 1.0E-100
sp|Q08269|ALR1_YEAST Magnesium transporter ALR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR1 PE=1 SV=1 646 958 1.0E-94
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 712 977 2.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 651 980 3.0E-124
sp|O13657|YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi066 PE=1 SV=1 635 975 7.0E-116
sp|P43553|ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR2 PE=1 SV=1 646 974 1.0E-100
sp|Q08269|ALR1_YEAST Magnesium transporter ALR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR1 PE=1 SV=1 646 958 1.0E-94
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 712 977 2.0E-81
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 22 273 6.0E-41
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 33 276 3.0E-35
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 41 262 6.0E-35
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 34 247 8.0E-27
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 32 248 7.0E-26
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 501 704 5.0E-24
sp|Q9WZ31|CORA_THEMA Magnesium transport protein CorA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=corA PE=1 SV=1 666 975 4.0E-19
sp|O31543|YFJQ_BACSU Putative metal ion transporter YfjQ OS=Bacillus subtilis (strain 168) GN=yfjQ PE=3 SV=1 642 940 4.0E-16
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 440 539 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 719 741 22
2 916 938 22
3 953 972 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5844
MDMADSPPSVDARSDDEEGGYDTVTVGSDRRGVKLLFAKSKVYVHPTPSARDNVAGYIALLQQKTPSDRPSSPSS
TTSATPASSDLLLAWIPESALGDAAGLYAKADLSEAESPSAHPYLVPPPPTVTTMAGSVGGYAFAVPLSAIFSLL
VRPPSVGWWHGSMVVNARNGEGAFPALFFHDGECQSTMLQKKRLARDAFDPFGEDGRAFWGADEVLRWLRRYVRL
ERSGPEPNVYLMEPSHEDLESFGQNSAAAAAAASSSVHNPYATPAATRLRAMHSDNEAPDESAPLLSDTGRRRAS
PADPLGYGAADLRSGRARSRRGSSRSSRSRTRLPATSAIKDSYHVNHPPSVPGSPIFGAADHPEMVFGDVMIRDE
LSLRSGSPRFSLNDDDADLSTVDGPVRDHRTDHGHGRRHTATATGDVCFPVRGMSEIGEEEETHSRDQHHYRSRR
RRGQWPDLETLEEWKRFEKEENSEGRRVKKITEPQLINGRLRPVRKGWYQSDDEAPYRFTYFNEEFQSTIHSPTI
SELVQPGGDFRELFIPDPRVLSDDESDDDVEPPSPQSKPCGATSNINLNTTRSGDGGPRTPTRLPSYSDTRRGDG
FASPARDTASNVPASGRATPRSIPREIKTQSRDRDSASTTKPVRYGDRPVWWLDVLCPTEAEMKVIAKAFGIHPL
TAEDIMVQEAREKVELFRNYYFVNYRTFDQDLNSGNDLEPVNMYVVVFRESVLSFHFSMTPHSANVRRRIRQLRD
YLILSSDWISYAIIDDITDVFQPLIQNIEAEVDEIDGEILQLHSSADKRIKDQKSSSKNDDNATAIVDSSDMLRR
VGDCRKRVMSLYRLLGNKADVIKGFAKRCNERWEVAPRSEIGLYLGDIQDHIVTMTSNLGHYEKILARTHANYLA
QINIRMNERQEQTADVLGRLTVLGTIVLPMNIITGLWGMNVWVPGQQYEGDLAWFVWITVGLICFGLACYLIAKR
VYKIV*
Coding >Ophun1|5844
ATGGACATGGCAGACTCACCGCCCAGCGTCGACGCTCGCTCTGATGATGAGGAAGGAGGCTACGATACCGTCACC
GTCGGCTCCGACCGTCGAGGCGTAAAGCTCCTCTTCGCAAAGAGCAAGGTCTACGTCCATCCCACGCCGTCAGCA
CGCGACAATGTCGCAGGCTACATCGCCCTCCTCCAGCAAAAGACGCCCTCCGACCGTCCATCCTCACCATCCTCA
ACCACCTCCGCCACCCCCGCCTCCTCCGACCTGCTCCTCGCCTGGATCCCCGAGTCGGCACTGGGCGATGCGGCG
GGATTATACGCCAAGGCCGATCTCAGCGAAGCGGAATCCCCCTCCGCGCACCCGTATCTCGTCCCGCCGCCGCCG
ACGGTGACGACGATGGCGGGTTCGGTGGGGGGCTACGCTTTCGCCGTTCCGCTGAGTGCCATCTTCTCGCTGCTC
GTTCGGCCGCCGAGCGTGGGGTGGTGGCATGGGTCCATGGTCGTTAACGCGCGGAACGGGGAGGGTGCGTTTCCT
GCTTTGTTCTTTCATGATGGGGAGTGTCAGAGTACGATGCTGCAGAAGAAGAGGCTTGCGCGCGATGCTTTTGAT
CCGTTTGGTGAGGATGGACGCGCGTTTTGGGGCGCGGATGAGGTTTTGCGTTGGTTGCGTCGATATGTCCGTCTT
GAGCGCTCCGGCCCAGAACCAAATGTGTATCTGATGGAGCCGAGCCACGAAGATCTCGAATCCTTTGGCCAGAAT
TCAGCCGCCGCCGCCGCCGCCGCTTCCAGCTCCGTTCACAATCCCTATGCTACTCCGGCTGCCACCCGGCTTCGA
GCCATGCACAGCGATAACGAAGCTCCCGACGAGTCGGCCCCGTTGCTGTCCGATACGGGCCGTCGCCGAGCCTCA
CCGGCGGATCCTTTAGGCTACGGCGCCGCGGATCTGCGATCCGGTCGAGCCCGAAGCCGTCGCGGTTCTAGCCGA
TCGTCGAGGTCCAGGACAAGACTGCCGGCCACGTCGGCTATCAAGGACTCGTACCATGTCAATCACCCGCCCTCG
GTCCCGGGCTCGCCCATCTTCGGCGCCGCCGATCACCCGGAGATGGTCTTTGGCGATGTCATGATACGCGACGAG
CTGTCGTTGCGCAGTGGCAGCCCCCGTTTCTCCCTCAACGACGACGATGCCGACCTCTCAACCGTCGACGGTCCC
GTTCGAGATCACCGTACTGATCATGGCCACGGCCGGAGACACACCGCGACTGCCACCGGCGACGTCTGCTTCCCG
GTCCGCGGCATGTCCGAGATCGGCGAGGAGGAAGAGACGCATTCGCGAGACCAGCACCACTACAGGTCACGACGC
CGCCGCGGCCAGTGGCCCGACCTGGAGACGCTCGAGGAGTGGAAGCGCTTCGAGAAGGAGGAGAATAGTGAGGGG
AGGCGGGTCAAGAAGATTACCGAGCCCCAGCTCATCAATGGCCGTCTCCGTCCCGTCCGCAAGGGCTGGTACCAG
TCCGACGACGAGGCGCCTTACAGATTCACCTACTTCAACGAGGAGTTTCAGAGCACCATTCACAGTCCCACCATA
TCCGAGCTCGTCCAGCCGGGAGGCGACTTTCGCGAGCTCTTCATACCCGATCCGCGCGTCCTGTCCGATGACGAG
TCTGACGATGATGTCGAGCCCCCGTCGCCTCAGTCCAAGCCTTGCGGCGCCACCTCAAACATCAACCTCAACACC
ACAAGAAGCGGCGATGGAGGACCGAGGACGCCGACTCGGCTGCCGTCGTACTCGGACACTCGTCGCGGCGACGGA
TTTGCCTCGCCGGCTCGGGACACGGCAAGCAATGTGCCGGCTTCGGGCCGTGCGACGCCCCGGTCCATCCCGCGT
GAGATCAAGACGCAGTCTCGCGACCGGGATTCGGCCTCGACGACGAAGCCGGTCCGGTACGGAGACCGGCCGGTG
TGGTGGCTCGATGTTCTCTGTCCGACCGAGGCGGAAATGAAGGTCATCGCCAAGGCATTTGGCATTCACCCGCTC
ACGGCCGAGGATATCATGGTGCAGGAGGCTCGGGAAAAGGTCGAGCTCTTTCGCAACTACTACTTCGTCAACTAC
CGCACCTTCGATCAGGATCTCAACAGCGGTAACGATCTCGAACCCGTCAACATGTACGTCGTCGTCTTCCGCGAG
AGCGTCCTCAGCTTCCACTTTTCCATGACGCCTCATTCCGCCAACGTCCGGAGGCGGATCCGGCAGCTCAGAGAC
TACCTGATCCTCTCGTCTGATTGGATCTCGTACGCCATCATCGACGACATCACCGACGTCTTTCAGCCCTTGATC
CAGAACATCGAGGCTGAGGTCGATGAGATTGACGGCGAGATTCTTCAGCTGCATTCTTCGGCCGACAAGCGCATC
AAGGATCAGAAGAGCTCGTCCAAGAATGACGACAACGCGACGGCCATTGTCGACTCGAGTGATATGCTGCGCCGC
GTCGGAGATTGCAGGAAGAGGGTCATGAGTCTTTACCGTCTGCTCGGCAACAAGGCCGACGTCATCAAGGGCTTT
GCCAAGCGGTGCAACGAGAGGTGGGAGGTGGCGCCGCGGTCAGAGATTGGTTTATACCTGGGCGACATTCAGGAT
CATATAGTGACCATGACGTCCAACCTGGGTCACTACGAGAAGATCTTGGCCCGAACGCACGCCAACTACCTCGCA
CAGATCAACATTCGCATGAACGAGCGACAGGAGCAGACCGCCGACGTCCTGGGCAGGCTAACGGTGCTGGGCACC
ATCGTCCTCCCCATGAACATCATCACCGGCCTCTGGGGCATGAACGTCTGGGTCCCCGGCCAGCAGTACGAGGGA
GACCTGGCGTGGTTCGTCTGGATCACCGTCGGACTCATCTGCTTCGGTCTGGCGTGCTACCTCATCGCCAAGCGG
GTGTATAAGATTGTCTAG
Transcript >Ophun1|5844
ATGGACATGGCAGACTCACCGCCCAGCGTCGACGCTCGCTCTGATGATGAGGAAGGAGGCTACGATACCGTCACC
GTCGGCTCCGACCGTCGAGGCGTAAAGCTCCTCTTCGCAAAGAGCAAGGTCTACGTCCATCCCACGCCGTCAGCA
CGCGACAATGTCGCAGGCTACATCGCCCTCCTCCAGCAAAAGACGCCCTCCGACCGTCCATCCTCACCATCCTCA
ACCACCTCCGCCACCCCCGCCTCCTCCGACCTGCTCCTCGCCTGGATCCCCGAGTCGGCACTGGGCGATGCGGCG
GGATTATACGCCAAGGCCGATCTCAGCGAAGCGGAATCCCCCTCCGCGCACCCGTATCTCGTCCCGCCGCCGCCG
ACGGTGACGACGATGGCGGGTTCGGTGGGGGGCTACGCTTTCGCCGTTCCGCTGAGTGCCATCTTCTCGCTGCTC
GTTCGGCCGCCGAGCGTGGGGTGGTGGCATGGGTCCATGGTCGTTAACGCGCGGAACGGGGAGGGTGCGTTTCCT
GCTTTGTTCTTTCATGATGGGGAGTGTCAGAGTACGATGCTGCAGAAGAAGAGGCTTGCGCGCGATGCTTTTGAT
CCGTTTGGTGAGGATGGACGCGCGTTTTGGGGCGCGGATGAGGTTTTGCGTTGGTTGCGTCGATATGTCCGTCTT
GAGCGCTCCGGCCCAGAACCAAATGTGTATCTGATGGAGCCGAGCCACGAAGATCTCGAATCCTTTGGCCAGAAT
TCAGCCGCCGCCGCCGCCGCCGCTTCCAGCTCCGTTCACAATCCCTATGCTACTCCGGCTGCCACCCGGCTTCGA
GCCATGCACAGCGATAACGAAGCTCCCGACGAGTCGGCCCCGTTGCTGTCCGATACGGGCCGTCGCCGAGCCTCA
CCGGCGGATCCTTTAGGCTACGGCGCCGCGGATCTGCGATCCGGTCGAGCCCGAAGCCGTCGCGGTTCTAGCCGA
TCGTCGAGGTCCAGGACAAGACTGCCGGCCACGTCGGCTATCAAGGACTCGTACCATGTCAATCACCCGCCCTCG
GTCCCGGGCTCGCCCATCTTCGGCGCCGCCGATCACCCGGAGATGGTCTTTGGCGATGTCATGATACGCGACGAG
CTGTCGTTGCGCAGTGGCAGCCCCCGTTTCTCCCTCAACGACGACGATGCCGACCTCTCAACCGTCGACGGTCCC
GTTCGAGATCACCGTACTGATCATGGCCACGGCCGGAGACACACCGCGACTGCCACCGGCGACGTCTGCTTCCCG
GTCCGCGGCATGTCCGAGATCGGCGAGGAGGAAGAGACGCATTCGCGAGACCAGCACCACTACAGGTCACGACGC
CGCCGCGGCCAGTGGCCCGACCTGGAGACGCTCGAGGAGTGGAAGCGCTTCGAGAAGGAGGAGAATAGTGAGGGG
AGGCGGGTCAAGAAGATTACCGAGCCCCAGCTCATCAATGGCCGTCTCCGTCCCGTCCGCAAGGGCTGGTACCAG
TCCGACGACGAGGCGCCTTACAGATTCACCTACTTCAACGAGGAGTTTCAGAGCACCATTCACAGTCCCACCATA
TCCGAGCTCGTCCAGCCGGGAGGCGACTTTCGCGAGCTCTTCATACCCGATCCGCGCGTCCTGTCCGATGACGAG
TCTGACGATGATGTCGAGCCCCCGTCGCCTCAGTCCAAGCCTTGCGGCGCCACCTCAAACATCAACCTCAACACC
ACAAGAAGCGGCGATGGAGGACCGAGGACGCCGACTCGGCTGCCGTCGTACTCGGACACTCGTCGCGGCGACGGA
TTTGCCTCGCCGGCTCGGGACACGGCAAGCAATGTGCCGGCTTCGGGCCGTGCGACGCCCCGGTCCATCCCGCGT
GAGATCAAGACGCAGTCTCGCGACCGGGATTCGGCCTCGACGACGAAGCCGGTCCGGTACGGAGACCGGCCGGTG
TGGTGGCTCGATGTTCTCTGTCCGACCGAGGCGGAAATGAAGGTCATCGCCAAGGCATTTGGCATTCACCCGCTC
ACGGCCGAGGATATCATGGTGCAGGAGGCTCGGGAAAAGGTCGAGCTCTTTCGCAACTACTACTTCGTCAACTAC
CGCACCTTCGATCAGGATCTCAACAGCGGTAACGATCTCGAACCCGTCAACATGTACGTCGTCGTCTTCCGCGAG
AGCGTCCTCAGCTTCCACTTTTCCATGACGCCTCATTCCGCCAACGTCCGGAGGCGGATCCGGCAGCTCAGAGAC
TACCTGATCCTCTCGTCTGATTGGATCTCGTACGCCATCATCGACGACATCACCGACGTCTTTCAGCCCTTGATC
CAGAACATCGAGGCTGAGGTCGATGAGATTGACGGCGAGATTCTTCAGCTGCATTCTTCGGCCGACAAGCGCATC
AAGGATCAGAAGAGCTCGTCCAAGAATGACGACAACGCGACGGCCATTGTCGACTCGAGTGATATGCTGCGCCGC
GTCGGAGATTGCAGGAAGAGGGTCATGAGTCTTTACCGTCTGCTCGGCAACAAGGCCGACGTCATCAAGGGCTTT
GCCAAGCGGTGCAACGAGAGGTGGGAGGTGGCGCCGCGGTCAGAGATTGGTTTATACCTGGGCGACATTCAGGAT
CATATAGTGACCATGACGTCCAACCTGGGTCACTACGAGAAGATCTTGGCCCGAACGCACGCCAACTACCTCGCA
CAGATCAACATTCGCATGAACGAGCGACAGGAGCAGACCGCCGACGTCCTGGGCAGGCTAACGGTGCTGGGCACC
ATCGTCCTCCCCATGAACATCATCACCGGCCTCTGGGGCATGAACGTCTGGGTCCCCGGCCAGCAGTACGAGGGA
GACCTGGCGTGGTTCGTCTGGATCACCGTCGGACTCATCTGCTTCGGTCTGGCGTGCTACCTCATCGCCAAGCGG
GTGTATAAGATTGTCTAG
Gene >Ophun1|5844
ATGGACATGGCAGACTCACCGCCCAGCGTCGACGCTCGCTCTGATGATGAGGAAGGAGGCTACGATACCGTCACC
GTCGGCTCCGACCGTCGAGGCGTAAAGCTCCTCTTCGCAAAGAGCAAGGTCTACGTCCATCCCACGCCGTCAGCA
CGCGACAATGTCGCAGGCTACATCGCCCTCCTCCAGCAAAAGACGCCCTCCGACCGTCCATCCTCACCATCCTCA
ACCACCTCCGCCACCCCCGCCTCCTCCGACCTGCTCCTCGCCTGGATCCCCGAGTCGGCACTGGGCGATGCGGCG
GGATTATACGCCAAGGCCGATCTCAGCGAAGCGGAATCCCCCTCCGCGCACCCGTATCTCGTCCCGCCGCCGCCG
ACGGTGACGACGATGGCGGGTTCGGTGGGGGGCTACGCTTTCGCCGTTCCGCTGAGTGCCATCTTCTCGCTGCTC
GTTCGGCCGCCGAGCGTGGGGTGGTGGCATGGGTCCATGGTCGTTAACGCGCGGAACGGGGAGGGTGCGTTTCCT
GCTTTGTTCTTTCATGATGGGGAGTGTCAGAGTACGATGCTGCAGAAGAAGAGGCTTGCGCGCGATGCTTTTGAT
CCGTTTGGTGAGGATGGACGCGCGTTTTGGGGCGCGGATGAGGTTTTGCGTTGGTTGCGTCGATATGTCCGTCTT
GAGCGCTCCGGCCCAGAACCAAATGTGTATCTGATGGAGCCGAGCCACGAAGATCTCGAATCCTTTGGCCAGAAT
TCAGCCGCCGCCGCCGCCGCCGCTTCCAGCTCCGTTCACAATCCCTATGCTACTCCGGCTGCCACCCGGCTTCGA
GCCATGCACAGCGATAACGAAGCTCCCGACGAGTCGGCCCCGTTGCTGTCCGATACGGGCCGTCGCCGAGCCTCA
CCGGCGGATCCTTTAGGCTACGGCGCCGCGGATCTGCGATCCGGTCGAGCCCGAAGCCGTCGCGGTTCTAGCCGA
TCGTCGAGGTCCAGGACAAGACTGCCGGCCACGTCGGCTATCAAGGACTCGTACCATGTCAATCACCCGCCCTCG
GTCCCGGGCTCGCCCATCTTCGGCGCCGCCGATCACCCGGAGATGGTCTTTGGCGATGTCATGATACGCGACGAG
CTGTCGTTGCGCAGTGGCAGCCCCCGTTTCTCCCTCAACGACGACGATGCCGACCTCTCAACCGTCGACGGTCCC
GTTCGAGATCACCGTACTGATCATGGCCACGGCCGGAGACACACCGCGACTGCCACCGGCGACGTCTGCTTCCCG
GTCCGCGGCATGTCCGAGATCGGCGAGGAGGAAGAGACGCATTCGCGAGACCAGCACCACTACAGGTCACGACGC
CGCCGCGGCCAGTGGCCCGACCTGGAGACGCTCGAGGAGTGGAAGCGCTTCGAGAAGGAGGAGAATAGTGAGGGG
AGGCGGGTCAAGAAGATTACCGAGCCCCAGCTCATCAATGGCCGTCTCCGTCCCGTCCGCAAGGGCTGGTACCAG
TCCGACGACGAGGCGCCTTACAGATTCACCTACTTCAACGAGGAGTTTCAGAGCACCATTCACAGTCCCACCATA
TCCGAGCTCGTCCAGCCGGGAGGCGACTTTCGCGAGCTCTTCATACCCGATCCGCGCGTCCTGTCCGATGACGAG
TCTGACGATGATGTCGAGCCCCCGTCGCCTCAGTCCAAGCCTTGCGGCGCCACCTCAAACATCAACCTCAACACC
ACAAGAAGCGGCGATGGAGGACCGAGGACGCCGACTCGGCTGCCGTCGTACTCGGACACTCGTCGCGGCGACGGA
TTTGCCTCGCCGGCTCGGGACACGGCAAGCAATGTGCCGGCTTCGGGCCGTGCGACGCCCCGGTCCATCCCGCGT
GAGATCAAGACGCAGTCTCGCGACCGGGATTCGGCCTCGACGACGAAGCCGGTCCGGTACGGAGACCGGCCGGTG
TGGTGGCTCGATGTTCTCTGTCCGACCGAGGCGGAAATGAAGGTCATCGCCAAGGCATTTGGCATTCACCCGCTC
ACGGCCGAGGATATCATGGTGCAGGAGGCTCGGGAAAAGGTCGAGCTCTTTCGCAACTACTACTTCGTCAACTAC
CGCACCTTCGATCAGGATCTCAACAGCGGTAACGATCTCGAACCCGTCAACATGTACGTCGTCGTCTTCCGCGAG
AGCGTCCTCAGCTTCCACTTTTCCATGACGCCTCATTCCGCCAACGTCCGGAGGCGGATCCGGCAGCTCAGAGAC
TACCTGATCCTCTCGTCTGATTGGATCTCGTACGCCATCATCGACGACATCACCGACGTCTTTCAGCCCTTGATC
CAGAACATCGAGGCTGAGGTCGATGAGATTGACGGCGAGATTCTTCAGCTGCATTCTTCGGCCGACAAGCGCATC
AAGGATCAGAAGAGCTCGTCCAAGAATGACGACAACGCGACGGCCATTGTCGACTCGAGTGATATGCTGCGCCGC
GTCGGAGATTGCAGGAAGAGGGTCATGAGTCTTTACCGTCTGCTCGGCAACAAGGCCGACGTCATCAAGGGCTTT
GCCAAGCGGTGCAACGAGAGGTGGGAGGTGGCGCCGCGGTCAGAGATTGGTTTATACCTGGGCGACATTCAGGAT
CATATAGTGACCATGACGTCCAACCTGGGTCACTACGAGAAGTAAGGCCCTTTTTCCCCCCCTTCCGCCCTCGTC
GTCTACGGCAGAGGTATGCTGACCTTCCTGACAGGATCTTGGCCCGAACGCACGCCAACTACCTCGCACAGATCA
ACATTCGCATGAACGAGCGACAGGAGCAGACCGCCGACGTCCTGGGCAGGCTAACGGTGCTGGGCACCATCGTCC
TCCCCATGAACATCATCACCGGCCTCTGGGGCATGAACGTCTGGGTCCCCGGCCAGCAGTACGAGGGAGACCTGG
CGTGGTTCGTCTGGATCACCGTCGGACTCATCTGCTTCGGTCTGGCGTGCTACCTCATCGCCAAGCGGGTGTATA
AGATTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail