Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5843
Gene name
LocationContig_6:86061..87412
Strand+
Gene length (bp)1351
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 1.9E-31 144 351

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 109 131 22
3 177 196 19
4 216 238 22
5 284 306 22
6 313 335 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2139
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2436
Ophiocordyceps australis map64 (Brazil) OphauB2|1666
Ophiocordyceps camponoti-floridani Ophcf2|05337
Ophiocordyceps camponoti-rufipedis Ophun1|5843 (this protein)
Ophiocordyceps kimflemingae Ophio5|4910
Ophiocordyceps subramaniannii Hirsu2|2570

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5843
MVLGAVLEPLVVVTLLFGGAWVNRSRKGAVDFVVDDYEDDDDLEGKRRRSGSSSWSGSSDATFATISSTRTRRVR
LLKWEADVSTPNTAVFANRGLSRLLRKFPFLVEAWYWALIYWVYQVARAVTALTLVEGTVDVARKHALQVIHLEQ
QLGILLEPQVQRFFLSHPLLLHWTNRVYSFIHIPGTIFFLVSLFYLTTTTRRASPALYEARRRSMAMCNLVAFVV
FTVWPCMPPRLLSDAGYRGEDAAEAKGYGFVDTVHSKAGESSVWTTNRFCNQYAAMPSLHFGYSLLIGLTIATLP
LPSLRWTSWKRLAIVAVGIAYPTLILTAIVATANHFILDAVAGALVCAFAWRTNDLLLNLLVLEDYFLCLLRIHK
PGNDEVLVGPDTRRLLKDET*
Coding >Ophun1|5843
ATGGTTCTGGGTGCGGTGCTGGAGCCGTTGGTTGTTGTTACGCTTCTGTTTGGGGGTGCGTGGGTGAATCGGTCG
CGGAAAGGGGCTGTCGATTTCGTGGTCGATGACTATGAGGATGACGACGACTTGGAGGGCAAGAGGCGACGGTCC
GGATCCAGTTCCTGGAGTGGAAGCTCGGATGCTACCTTTGCGACCATATCATCGACTCGGACGCGGAGGGTGCGG
CTCTTGAAGTGGGAGGCGGACGTGTCGACGCCCAATACTGCCGTCTTTGCGAATAGGGGGTTGAGCCGACTTCTG
AGGAAGTTTCCCTTTCTGGTCGAGGCTTGGTATTGGGCTCTTATCTACTGGGTGTATCAAGTTGCCCGCGCCGTC
ACGGCCCTTACCCTCGTTGAAGGCACCGTCGACGTCGCTCGCAAACACGCCCTGCAGGTAATCCACCTCGAACAA
CAGCTCGGCATCCTCCTCGAACCGCAAGTCCAACGCTTCTTCCTCTCGCACCCGCTCCTCCTGCACTGGACCAAC
AGGGTCTACTCCTTCATCCACATCCCCGGCACCATCTTCTTCCTCGTCAGCCTCTTCTACCTCACGACGACGACC
CGACGCGCCAGCCCAGCCCTGTACGAAGCGCGACGCAGATCAATGGCCATGTGCAACCTCGTCGCCTTTGTCGTC
TTTACCGTTTGGCCGTGTATGCCGCCCAGACTGCTCAGCGACGCCGGCTATCGCGGTGAGGACGCGGCGGAGGCC
AAGGGGTATGGCTTCGTCGATACGGTTCATTCCAAGGCGGGGGAGAGCAGCGTCTGGACGACGAATCGCTTCTGC
AACCAATACGCCGCAATGCCGTCCTTACACTTTGGCTACTCTCTCCTCATCGGCCTCACCATCGCCACGCTACCA
CTACCGAGCCTCCGCTGGACGTCATGGAAGCGGCTGGCCATCGTGGCCGTGGGAATCGCGTACCCGACGCTGATA
CTCACCGCCATCGTGGCGACGGCGAATCACTTCATCCTCGATGCCGTTGCCGGCGCCCTCGTCTGCGCATTCGCA
TGGCGCACCAACGACCTGCTCTTGAATCTCCTCGTGCTGGAAGATTACTTCCTCTGTCTGCTTCGTATTCATAAG
CCGGGGAATGACGAGGTGCTGGTTGGGCCGGATACGAGGAGGCTGCTGAAAGATGAGACTTGA
Transcript >Ophun1|5843
ATGGTTCTGGGTGCGGTGCTGGAGCCGTTGGTTGTTGTTACGCTTCTGTTTGGGGGTGCGTGGGTGAATCGGTCG
CGGAAAGGGGCTGTCGATTTCGTGGTCGATGACTATGAGGATGACGACGACTTGGAGGGCAAGAGGCGACGGTCC
GGATCCAGTTCCTGGAGTGGAAGCTCGGATGCTACCTTTGCGACCATATCATCGACTCGGACGCGGAGGGTGCGG
CTCTTGAAGTGGGAGGCGGACGTGTCGACGCCCAATACTGCCGTCTTTGCGAATAGGGGGTTGAGCCGACTTCTG
AGGAAGTTTCCCTTTCTGGTCGAGGCTTGGTATTGGGCTCTTATCTACTGGGTGTATCAAGTTGCCCGCGCCGTC
ACGGCCCTTACCCTCGTTGAAGGCACCGTCGACGTCGCTCGCAAACACGCCCTGCAGGTAATCCACCTCGAACAA
CAGCTCGGCATCCTCCTCGAACCGCAAGTCCAACGCTTCTTCCTCTCGCACCCGCTCCTCCTGCACTGGACCAAC
AGGGTCTACTCCTTCATCCACATCCCCGGCACCATCTTCTTCCTCGTCAGCCTCTTCTACCTCACGACGACGACC
CGACGCGCCAGCCCAGCCCTGTACGAAGCGCGACGCAGATCAATGGCCATGTGCAACCTCGTCGCCTTTGTCGTC
TTTACCGTTTGGCCGTGTATGCCGCCCAGACTGCTCAGCGACGCCGGCTATCGCGGTGAGGACGCGGCGGAGGCC
AAGGGGTATGGCTTCGTCGATACGGTTCATTCCAAGGCGGGGGAGAGCAGCGTCTGGACGACGAATCGCTTCTGC
AACCAATACGCCGCAATGCCGTCCTTACACTTTGGCTACTCTCTCCTCATCGGCCTCACCATCGCCACGCTACCA
CTACCGAGCCTCCGCTGGACGTCATGGAAGCGGCTGGCCATCGTGGCCGTGGGAATCGCGTACCCGACGCTGATA
CTCACCGCCATCGTGGCGACGGCGAATCACTTCATCCTCGATGCCGTTGCCGGCGCCCTCGTCTGCGCATTCGCA
TGGCGCACCAACGACCTGCTCTTGAATCTCCTCGTGCTGGAAGATTACTTCCTCTGTCTGCTTCGTATTCATAAG
CCGGGGAATGACGAGGTGCTGGTTGGGCCGGATACGAGGAGGCTGCTGAAAGATGAGACTTGA
Gene >Ophun1|5843
ATGGTTCTGGGTGCGGTGCTGGAGCCGTTGGTTGTTGTTACGCTTCTGTTTGGGGGTGCGTGGGTGAATCGGTCG
CGGAAAGGGGCTGTCGATTTCGTGGTCGATGACTATGAGGATGACGACGACTTGGAGGGCAAGAGGCGACGGTCC
GGATCCAGTTCCTGGAGTGGAAGCTCGGATGCTACCTTTGCGACCATATCATCGACTCGGACGCGGAGGGTGCGG
CTCTTGAAGTGGGAGGCGGACGTGTCGACGCCCAATACTGCCGTCTTTGCGAATAGGGGGTTGAGCCGACTTCTG
AGGAAGTTTCCCTTTCTGGTCGAGGCTTGGTATTGGGCTCTTATCTACTGGGTGAGTTTCTTCCCTCTCGAGATG
CTGTTGCTGTGTTGCTAATCATGGATGGTAGGTGTATCAAGTTGCCCGCGCCGTCACGGCCCTTACCCTCGTTGA
AGGCACCGTCGACGTCGCTCGCAAACACGCCCTGCAGGTAATCCACCTCGAACAACAGCTCGGCATCCTCCTCGA
ACCGCAAGTCCAACGCTTCTTCCTCTCGCACCCGCTCCTCCTGCACTGGACCAACAGGGTCTACTCCTTCATCCA
CATCCCCGGCACCATCTTCTTCCTCGTCAGCCTCTTCTACCTCACGACGACGACCCGACGCGCCAGCCCAGCCCT
GTACGAAGCGCGACGCAGATCAATGGCCATGTGCAACCTCGTCGCCTTTGTCGTCTTTACCGTTTGGCCGTGTAT
GCCGCCCAGACTGCTCAGCGACGCCGGCTATCGCGGTGAGGACGCGGCGGAGGCCAAGGGGTATGGCTTCGTCGA
TACGGTTCATTCCAAGGCGGGGGAGAGCAGCGTCTGGACGACGAATCGCTTCTGCAACCAATACGGTCAGTCTAC
CATAACAAAAAGGGGGGACGAGGAAAAAAAGAAATAATCGACGGTTCCTGTTCGGCAACATGTGCCGATGGATGC
ATCTTGCTAACGTGCCGTCACAGCCGCAATGCCGTCCTTACACTTTGGCTACTCTCTCCTCATCGGCCTCACCAT
CGCCACGCTACCACTACCGAGCCTCCGCTGGACGTCATGGAAGCGGCTGGCCATCGTGGCCGTGGGAATCGCGTA
CCCGACGCTGATACTCACCGCCATCGTGGCGACGGCGAATCACTTCATCCTCGATGCCGTTGCCGGCGCCCTCGT
CTGCGCATTCGCATGGCGCACCAACGACCTGCTCTTGAATCTCCTCGTGCTGGAAGATTACTTCCTCTGTCTGCT
TCGTATTCATAAGCCGGGGAATGACGAGGTGCTGGTTGGGCCGGATACGAGGAGGCTGCTGAAAGATGAGACTTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail