Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5843
Gene name
LocationContig_6:86061..87412
Strand+
Gene length (bp)1351
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 1.9E-31 144 351

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 109 131 22
3 177 196 19
4 216 238 22
5 284 306 22
6 313 335 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5843
MVLGAVLEPLVVVTLLFGGAWVNRSRKGAVDFVVDDYEDDDDLEGKRRRSGSSSWSGSSDATFATISSTRTRRVR
LLKWEADVSTPNTAVFANRGLSRLLRKFPFLVEAWYWALIYWVYQVARAVTALTLVEGTVDVARKHALQVIHLEQ
QLGILLEPQVQRFFLSHPLLLHWTNRVYSFIHIPGTIFFLVSLFYLTTTTRRASPALYEARRRSMAMCNLVAFVV
FTVWPCMPPRLLSDAGYRGEDAAEAKGYGFVDTVHSKAGESSVWTTNRFCNQYAAMPSLHFGYSLLIGLTIATLP
LPSLRWTSWKRLAIVAVGIAYPTLILTAIVATANHFILDAVAGALVCAFAWRTNDLLLNLLVLEDYFLCLLRIHK
PGNDEVLVGPDTRRLLKDET*
Coding >Ophun1|5843
ATGGTTCTGGGTGCGGTGCTGGAGCCGTTGGTTGTTGTTACGCTTCTGTTTGGGGGTGCGTGGGTGAATCGGTCG
CGGAAAGGGGCTGTCGATTTCGTGGTCGATGACTATGAGGATGACGACGACTTGGAGGGCAAGAGGCGACGGTCC
GGATCCAGTTCCTGGAGTGGAAGCTCGGATGCTACCTTTGCGACCATATCATCGACTCGGACGCGGAGGGTGCGG
CTCTTGAAGTGGGAGGCGGACGTGTCGACGCCCAATACTGCCGTCTTTGCGAATAGGGGGTTGAGCCGACTTCTG
AGGAAGTTTCCCTTTCTGGTCGAGGCTTGGTATTGGGCTCTTATCTACTGGGTGTATCAAGTTGCCCGCGCCGTC
ACGGCCCTTACCCTCGTTGAAGGCACCGTCGACGTCGCTCGCAAACACGCCCTGCAGGTAATCCACCTCGAACAA
CAGCTCGGCATCCTCCTCGAACCGCAAGTCCAACGCTTCTTCCTCTCGCACCCGCTCCTCCTGCACTGGACCAAC
AGGGTCTACTCCTTCATCCACATCCCCGGCACCATCTTCTTCCTCGTCAGCCTCTTCTACCTCACGACGACGACC
CGACGCGCCAGCCCAGCCCTGTACGAAGCGCGACGCAGATCAATGGCCATGTGCAACCTCGTCGCCTTTGTCGTC
TTTACCGTTTGGCCGTGTATGCCGCCCAGACTGCTCAGCGACGCCGGCTATCGCGGTGAGGACGCGGCGGAGGCC
AAGGGGTATGGCTTCGTCGATACGGTTCATTCCAAGGCGGGGGAGAGCAGCGTCTGGACGACGAATCGCTTCTGC
AACCAATACGCCGCAATGCCGTCCTTACACTTTGGCTACTCTCTCCTCATCGGCCTCACCATCGCCACGCTACCA
CTACCGAGCCTCCGCTGGACGTCATGGAAGCGGCTGGCCATCGTGGCCGTGGGAATCGCGTACCCGACGCTGATA
CTCACCGCCATCGTGGCGACGGCGAATCACTTCATCCTCGATGCCGTTGCCGGCGCCCTCGTCTGCGCATTCGCA
TGGCGCACCAACGACCTGCTCTTGAATCTCCTCGTGCTGGAAGATTACTTCCTCTGTCTGCTTCGTATTCATAAG
CCGGGGAATGACGAGGTGCTGGTTGGGCCGGATACGAGGAGGCTGCTGAAAGATGAGACTTGA
Transcript >Ophun1|5843
ATGGTTCTGGGTGCGGTGCTGGAGCCGTTGGTTGTTGTTACGCTTCTGTTTGGGGGTGCGTGGGTGAATCGGTCG
CGGAAAGGGGCTGTCGATTTCGTGGTCGATGACTATGAGGATGACGACGACTTGGAGGGCAAGAGGCGACGGTCC
GGATCCAGTTCCTGGAGTGGAAGCTCGGATGCTACCTTTGCGACCATATCATCGACTCGGACGCGGAGGGTGCGG
CTCTTGAAGTGGGAGGCGGACGTGTCGACGCCCAATACTGCCGTCTTTGCGAATAGGGGGTTGAGCCGACTTCTG
AGGAAGTTTCCCTTTCTGGTCGAGGCTTGGTATTGGGCTCTTATCTACTGGGTGTATCAAGTTGCCCGCGCCGTC
ACGGCCCTTACCCTCGTTGAAGGCACCGTCGACGTCGCTCGCAAACACGCCCTGCAGGTAATCCACCTCGAACAA
CAGCTCGGCATCCTCCTCGAACCGCAAGTCCAACGCTTCTTCCTCTCGCACCCGCTCCTCCTGCACTGGACCAAC
AGGGTCTACTCCTTCATCCACATCCCCGGCACCATCTTCTTCCTCGTCAGCCTCTTCTACCTCACGACGACGACC
CGACGCGCCAGCCCAGCCCTGTACGAAGCGCGACGCAGATCAATGGCCATGTGCAACCTCGTCGCCTTTGTCGTC
TTTACCGTTTGGCCGTGTATGCCGCCCAGACTGCTCAGCGACGCCGGCTATCGCGGTGAGGACGCGGCGGAGGCC
AAGGGGTATGGCTTCGTCGATACGGTTCATTCCAAGGCGGGGGAGAGCAGCGTCTGGACGACGAATCGCTTCTGC
AACCAATACGCCGCAATGCCGTCCTTACACTTTGGCTACTCTCTCCTCATCGGCCTCACCATCGCCACGCTACCA
CTACCGAGCCTCCGCTGGACGTCATGGAAGCGGCTGGCCATCGTGGCCGTGGGAATCGCGTACCCGACGCTGATA
CTCACCGCCATCGTGGCGACGGCGAATCACTTCATCCTCGATGCCGTTGCCGGCGCCCTCGTCTGCGCATTCGCA
TGGCGCACCAACGACCTGCTCTTGAATCTCCTCGTGCTGGAAGATTACTTCCTCTGTCTGCTTCGTATTCATAAG
CCGGGGAATGACGAGGTGCTGGTTGGGCCGGATACGAGGAGGCTGCTGAAAGATGAGACTTGA
Gene >Ophun1|5843
ATGGTTCTGGGTGCGGTGCTGGAGCCGTTGGTTGTTGTTACGCTTCTGTTTGGGGGTGCGTGGGTGAATCGGTCG
CGGAAAGGGGCTGTCGATTTCGTGGTCGATGACTATGAGGATGACGACGACTTGGAGGGCAAGAGGCGACGGTCC
GGATCCAGTTCCTGGAGTGGAAGCTCGGATGCTACCTTTGCGACCATATCATCGACTCGGACGCGGAGGGTGCGG
CTCTTGAAGTGGGAGGCGGACGTGTCGACGCCCAATACTGCCGTCTTTGCGAATAGGGGGTTGAGCCGACTTCTG
AGGAAGTTTCCCTTTCTGGTCGAGGCTTGGTATTGGGCTCTTATCTACTGGGTGAGTTTCTTCCCTCTCGAGATG
CTGTTGCTGTGTTGCTAATCATGGATGGTAGGTGTATCAAGTTGCCCGCGCCGTCACGGCCCTTACCCTCGTTGA
AGGCACCGTCGACGTCGCTCGCAAACACGCCCTGCAGGTAATCCACCTCGAACAACAGCTCGGCATCCTCCTCGA
ACCGCAAGTCCAACGCTTCTTCCTCTCGCACCCGCTCCTCCTGCACTGGACCAACAGGGTCTACTCCTTCATCCA
CATCCCCGGCACCATCTTCTTCCTCGTCAGCCTCTTCTACCTCACGACGACGACCCGACGCGCCAGCCCAGCCCT
GTACGAAGCGCGACGCAGATCAATGGCCATGTGCAACCTCGTCGCCTTTGTCGTCTTTACCGTTTGGCCGTGTAT
GCCGCCCAGACTGCTCAGCGACGCCGGCTATCGCGGTGAGGACGCGGCGGAGGCCAAGGGGTATGGCTTCGTCGA
TACGGTTCATTCCAAGGCGGGGGAGAGCAGCGTCTGGACGACGAATCGCTTCTGCAACCAATACGGTCAGTCTAC
CATAACAAAAAGGGGGGACGAGGAAAAAAAGAAATAATCGACGGTTCCTGTTCGGCAACATGTGCCGATGGATGC
ATCTTGCTAACGTGCCGTCACAGCCGCAATGCCGTCCTTACACTTTGGCTACTCTCTCCTCATCGGCCTCACCAT
CGCCACGCTACCACTACCGAGCCTCCGCTGGACGTCATGGAAGCGGCTGGCCATCGTGGCCGTGGGAATCGCGTA
CCCGACGCTGATACTCACCGCCATCGTGGCGACGGCGAATCACTTCATCCTCGATGCCGTTGCCGGCGCCCTCGT
CTGCGCATTCGCATGGCGCACCAACGACCTGCTCTTGAATCTCCTCGTGCTGGAAGATTACTTCCTCTGTCTGCT
TCGTATTCATAAGCCGGGGAATGACGAGGTGCTGGTTGGGCCGGATACGAGGAGGCTGCTGAAAGATGAGACTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail