Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|584
Gene name
LocationContig_118:33704..34421
Strand+
Gene length (bp)717
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20354 DUF6649 Family of unknown function (DUF6649) 4.0E-24 75 203

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2753
Ophiocordyceps australis map64 (Brazil) OphauB2|4428
Ophiocordyceps camponoti-floridani Ophcf2|03369
Ophiocordyceps camponoti-rufipedis Ophun1|584 (this protein)
Ophiocordyceps kimflemingae Ophio5|2260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|584
MSPQDALQQRPLQHRYPLPPSPTSHSRKRKAAPLDGGERRLSKRLSLLNLGVLPQSTPSLTLLPLTTCLPERSGS
KLYVPVETPSLSPSTPAPTPQQPPIQHDDVMQLDDDKHKVYIYNMDDDLSSDSEPDDGRLVFLPDIDRHLRQTRI
PPAVLASPEGELAGMQVVLYNDPRSLTVPEERDGVRRAILDARQRLRDKQKRERDEGAEARATTVYDMELEDSAD
VDAMDVDMCPRID*
Coding >Ophun1|584
ATGTCCCCCCAAGATGCCCTGCAACAGCGCCCGCTACAGCACCGCTACCCGCTACCACCATCCCCCACCAGCCAC
TCACGCAAGCGCAAGGCCGCCCCCCTCGACGGAGGCGAGCGTCGACTGTCGAAGCGCCTCAGCCTCCTCAATCTC
GGTGTGCTCCCGCAGTCTACCCCCAGCCTCACCCTCCTCCCGCTCACGACATGTCTTCCAGAAAGGAGCGGTTCC
AAGCTCTACGTCCCCGTCGAGACGCCGTCGCTCTCTCCCTCTACTCCCGCTCCGACGCCTCAGCAGCCCCCCATC
CAACACGACGACGTCATGCAGCTCGATGACGACAAGCACAAGGTCTACATCTACAACATGGACGACGACCTCTCG
TCCGATAGCGAGCCCGACGACGGCCGTCTCGTCTTTCTCCCGGATATCGACCGCCACCTCCGGCAGACGCGCATC
CCGCCCGCCGTACTCGCCAGTCCGGAAGGGGAGCTGGCGGGCATGCAGGTGGTGCTGTACAACGATCCGCGCTCG
TTGACGGTGCCTGAGGAGCGAGATGGTGTCCGGAGGGCCATTCTCGATGCCAGGCAGCGGTTGAGGGACAAACAG
AAGCGCGAGAGGGATGAGGGCGCCGAGGCCCGTGCGACGACCGTCTACGATATGGAGTTGGAAGACTCTGCCGAT
GTCGATGCCATGGACGTCGACATGTGTCCACGCATTGATTGA
Transcript >Ophun1|584
ATGTCCCCCCAAGATGCCCTGCAACAGCGCCCGCTACAGCACCGCTACCCGCTACCACCATCCCCCACCAGCCAC
TCACGCAAGCGCAAGGCCGCCCCCCTCGACGGAGGCGAGCGTCGACTGTCGAAGCGCCTCAGCCTCCTCAATCTC
GGTGTGCTCCCGCAGTCTACCCCCAGCCTCACCCTCCTCCCGCTCACGACATGTCTTCCAGAAAGGAGCGGTTCC
AAGCTCTACGTCCCCGTCGAGACGCCGTCGCTCTCTCCCTCTACTCCCGCTCCGACGCCTCAGCAGCCCCCCATC
CAACACGACGACGTCATGCAGCTCGATGACGACAAGCACAAGGTCTACATCTACAACATGGACGACGACCTCTCG
TCCGATAGCGAGCCCGACGACGGCCGTCTCGTCTTTCTCCCGGATATCGACCGCCACCTCCGGCAGACGCGCATC
CCGCCCGCCGTACTCGCCAGTCCGGAAGGGGAGCTGGCGGGCATGCAGGTGGTGCTGTACAACGATCCGCGCTCG
TTGACGGTGCCTGAGGAGCGAGATGGTGTCCGGAGGGCCATTCTCGATGCCAGGCAGCGGTTGAGGGACAAACAG
AAGCGCGAGAGGGATGAGGGCGCCGAGGCCCGTGCGACGACCGTCTACGATATGGAGTTGGAAGACTCTGCCGAT
GTCGATGCCATGGACGTCGACATGTGTCCACGCATTGATTGA
Gene >Ophun1|584
ATGTCCCCCCAAGATGCCCTGCAACAGCGCCCGCTACAGCACCGCTACCCGCTACCACCATCCCCCACCAGCCAC
TCACGCAAGCGCAAGGCCGCCCCCCTCGACGGAGGCGAGCGTCGACTGTCGAAGCGCCTCAGCCTCCTCAATCTC
GGTGTGCTCCCGCAGTCTACCCCCAGCCTCACCCTCCTCCCGCTCACGACATGTCTTCCAGAAAGGAGCGGTTCC
AAGCTCTACGTCCCCGTCGAGACGCCGTCGCTCTCTCCCTCTACTCCCGCTCCGACGCCTCAGCAGCCCCCCATC
CAACACGACGACGTCATGCAGCTCGATGACGACAAGCACAAGGTCTACATCTACAACATGGACGACGACCTCTCG
TCCGATAGCGAGCCCGACGACGGCCGTCTCGTCTTTCTCCCGGATATCGACCGCCACCTCCGGCAGACGCGCATC
CCGCCCGCCGTACTCGCCAGTCCGGAAGGGGAGCTGGCGGGCATGCAGGTGGTGCTGTACAACGATCCGCGCTCG
TTGACGGTGCCTGAGGAGCGAGATGGTGTCCGGAGGGCCATTCTCGATGCCAGGCAGCGGTTGAGGGACAAACAG
AAGCGCGAGAGGGATGAGGGCGCCGAGGCCCGTGCGACGACCGTCTACGATATGGAGTTGGAAGACTCTGCCGAT
GTCGATGCCATGGACGTCGACATGTGTCCACGCATTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail